Apo Related Words

examples: winterunderstandingcloud

Here are some words that are associated with apo: away, off, from, beyond, for, faraway, out, towards, by, into, furthermore, far, with, forby, outstrip, toward, forgo, at, outward, across, during, of, distant, wingspan, to, remote, besides, avaunt, apa, on. You can get the definitions of these apo related words by clicking on them. Also check out describing words for apo and find more words related to apo using ReverseDictionary.org

Words Related to apo

Below is a list of words related to apo. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to apo:

away off from beyond for faraway out towards by into furthermore far with forby outstrip toward forgo at outward across during of distant wingspan to remote besides avaunt apa on beside than go ada moreover yonder upon in aloof along since pao opa outbound forego outgo hereafter departure the withgo exit onto cii depart awayness hither outermost next hence bypass aside getaway within mac longa outgang avoid incoming farness lf egress exceed
related words continue after advertisement
thereupon decamp out of absent distance thereon abs therein vacate oda fro thereto thereafter alongside afar pass therefrom herewith hereupon hereby inside wend therewith avoidance ignore wherefrom whereby offski leave whereupon come that about whereon wherein whereas disappear whereto wherewith through whereof whereabouts kajan paa awd saa pdb agreement serine koro reductase mannose vit planta epsilon lata transferase akan lola homologue omo keto uma kanya operon dehydrogenase alfa ene lalo baga linea oxidase tama eta over oma doktor malo ras polypeptide alis uli malabo hydroxylase decarboxylase ubi nair isu erythrocytes pati proline allele franca synthetase lyase lipoprotein lla mol rho dolorosa glucoside digress ago therefore hereunto forthgoing whereat leftward whereafter wherever thereat outreach which hereof hereto almost until against forthpass forthgo departer fareworthy outpass overgo beleave forthgang wentest so's thereagainst overleave whereinto sidetrack leftosphere rbp carotenal ipgri apolipoprotein cytochrome microsomal tocopherol pombe sisi carboxylase ouabain globin reng syngeneic palmitate iwe carboxypeptidase galactosidase secretase oxygenase dinucleotide estrone valine thymidine dyan polyamine nje enos thyrotropin omegas isoenzymes hightail forleave whereunder outstep thereinafter forthcome hereon way out go away shove off make oneself scarce in addition at bay sod off next to pass by come out get by arm's length leave behind make away pop out come in for containment event turn off on way go by come off exit stage leave clear away close to go out silly mid off take leave inside out go back bow out take hike come on so long blow away up and leave umbilical vein superoxide dismutase make track get out of break away lateral pass come back slip away get away put out rush off run off

Popular Searches

Words Related to apo

As you've probably noticed, words related to "apo" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "apo" are: away, off, from, beyond, and for. There are 285 other words that are related to or similar to apo listed above. Hopefully the generated list of apo related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like apo may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is apo?

Also check out apo words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of apo themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr