Ash Related Words

examples: winterunderstandingcloud

Here are some words that are associated with ash: ash tree, flowering ash, wood, residue, tree, fraxinus, volcanic, dust, volcano, smoke, cloud, lava, genus fraxinus, fly ash, soot, hardwood, plume, burn, sawdust, snow, pyroclastic, eruption, vapor, methane, gaseous, mud, embers, mercury, sludge, pumice. You can get the definitions of these ash related words by clicking on them. Also check out describing words for ash and find more words related to ash using ReverseDictionary.org

Words Related to ash

Below is a list of words related to ash. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to ash:

ash tree flowering ash wood residue tree fraxinus volcanic dust volcano smoke cloud lava genus fraxinus fly ash soot hardwood plume burn sawdust snow pyroclastic eruption vapor methane gaseous mud embers mercury sludge pumice debris ozone gases sediment smog radioactivity fire aqueous change yggdrasil alter modify combustion ash-key ygdrasil maple basswood rosewood larch hickory poplar sapwood treen amboyna eucalyptus alder heartwood woodcutter
related words continue after advertisement
oakwood kingwood cedar algum fir aspen ironwood briarwood oak kauri whitewood birchwood hornbeam beechwood hazelwood yew brushwood cypress logwood particulate spewing clouds oaken mahogany woodfire plumes woody wooded beech spewed coppice elm poon hemlock woodburning chatwood copse topographic woodward teak balsa sequoia spruce tephra sumac lignin ashwood belched casuarina cinder coniferous ashes blackwood powder softwood sylvan hazel mist pine mesquite treeless woodcock willow birch rocks hydroxide vents underburn billowed burned ground seeps rowan sneezewood fumes camphorwood bogwood satinwood muskwood balsawood gray bicarbonate water yellowwood zebrawood woodsy olivewood guaiacum anigre anegre fiddlewood hinoki purplewood caustic eruptions lancewood ovangkol billowing springs lakes haze antilogging princewood fog baking sand rivers jacaranda erupting spilled vinewood flintwood magma burning scrapwood rubberwood sandarac fires paddlewood pearwood lemonwood cedarwood matchwood urn soda tulipwood toxic reservoir leopardwood sulphur beneath tigerwood elkwood surat woodless pallor limewood jarrahwood spew woodish pond stavewood woodware seepage flames toonwood belching grey waters woodchipper magellanic palmwood stovewood vapour molten basaltic ice volcanoes remains tidal ashe dry lauan leatherwood emirate brassie frost woodness woodchopper letterwood vent profit beefwood seeping melting woodmonger pipes ligneous freezing woodshaving blanketed gas brazilwood blue ash black ash hoop ash fraxinus velutina basket ash fraxinus dipetala fraxinus cuspidata arizona ash pumpkin ash manna ash oregon ash common european ash swamp ash fraxinus caroliniana fraxinus tomentosa mountain ash white ash fraxinus americana european ash fraxinus excelsior fraxinus texensis fraxinus quadrangulata fraxinus latifolia fraxinus nigra fraxinus oregona fraxinus ornus red ash bone ash downy ash fraxinus pennsylvanica brown ash dripping bosk devilwood formaldehyde raging geysers enveloped brook muddy oort sea spilling woodlike vapors thick kelp flame contamination temperatures swamp firestick acrid geyser groundwater sabicu sky lake particulates silt creosote radioactive slurry pollutants scoria sulfur sooty tailings pollen smokestack cinders unburnt landfill slag nitrate ejecta gypsum arsenic basalt latewood liquid earlywood forestial dyewood woodbin wagenboom barwood marblewood nakedwood sissoo sweetwood camwood arboraceous cocobolo woodboring coathanger fruitwood padauk bentwood keurboom treeify untreed treehood sideroxylon stemma dipterocarp souari treely cremains spews mantle tree barkston cupels sha'ab toxaphene cyclohexane juglone pentachlorophenol trichloroethane chippings mineral heat home chemical sample renewable resource lima wood black locust lignum vitae red lauan lignum rhodium burn in fireplace combustible game piece from tree dead tree combustible material holm oak durmast oak tulipwood tree live oak chestnut oak gum tree hop hornbeam tree product pine tree elm tree locust tree angiospermous tree fir tree sandalwood tree make furniture gymnospermous tree chestnut tree tea tree pepper tree white mangrove silver tree prickly ash gatten tree cork tree redox particulate matter sulfur dioxide hazardous waste portland cement volcanic eruption radioactive material volcanic rock carbon dioxide radioactive waste chromic acid hydrofluoric acid cirrus cloud cumulus cloud water vapor greenish yellow carbon tetrachloride incomplete combustion campfire fireplace charcoal organic compound wood ash

Popular Searches

Words Related to ash

As you've probably noticed, words related to "ash" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "ash" are: ash tree, flowering ash, wood, residue, and tree. There are 418 other words that are related to or similar to ash listed above. Hopefully the generated list of ash related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like ash may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is ash?

Also check out ash words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of ash themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr