Auk Related Words

examples: winterunderstandingcloud

Here are some words that are associated with auk: great auk, razorbill, common murre, bird, seabird, puffin, plover, pliocene, nightjar, wagtail, guillemot, penguin, least auklet, thick-billed murre, bird colony, little auk, eocene, genus, charadriiformes, cassowary, ibis, nightingale, stork, pelican, vulture, emu, falcon, finch, kingfisher, chickadee. You can get the definitions of these auk related words by clicking on them. Also check out describing words for auk and find more words related to auk using ReverseDictionary.org

Words Related to auk

Below is a list of words related to auk. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to auk:

great auk razorbill common murre bird seabird puffin plover pliocene nightjar wagtail guillemot penguin least auklet thick-billed murre bird colony little auk eocene genus charadriiformes cassowary ibis nightingale stork pelican vulture emu falcon finch kingfisher chickadee heron robin wildfowl raptor pheasant parrot cockatoo toucan petrel mockingbird flamingo ornithologist passerine peacock junco hummingbird wren albatross buzzard archaeopteryx birdlike birdcage starling trogon parakeet
related words continue after advertisement
tanager rhea coot birdman seagull quetzal magpie goldfinch goose fowl oriole protobird quail gerfalcon syrinx sparrow partridge dinosaur avian ostrich cuckoo blackbird hawk thrush vireo sunbird birdy oxpecker grackle eaglet skylark cockatiel waterfowl frigatebird cowbird lorikeet bristlebird songbird mallard birdwatcher grouse hornbill spurfowl curassow aves puffbird tern parrotfinch auklet alcidae seafowl dovekie bobwhite wattlebird wing swamphen birdfeeder ortygan birder uropygium birdwatch birddom gallinule bowerbird uria birdly birdish kittiwake indigobird birdlet cormorant shorebird jabiru birdproof honeycreeper hairbird figbird twitterer birdwoman gibberbird birdless anseriform columbiform ratite cepphus oilbird birdbolt gnatcatcher malurid birdkeeper mousebird morphology corniplume phasianid riflebird giblet epornitic cassican birdcatching bronzewing birdcatcher broadbill tufted puffin waterbird brachyramphus minivet oscine flufftail birdbrain wader debeak birdling pteryla buttonquail birdkeeping lari thornbird parrothouse carinate rostrate birdlime cadge skua birdskin zoofulvin remex rockfowl year idylls maha gildersleeve fossil hella rahi grandmama oryx bounteous bustard amphion scimitar baronage hathor sedum varuna babbler hote speranza turanian bee eater purslane uncrowned sirocco miocene lich wombat scaevola convergent evolution ancilla oceanus bacchante launcelot nabob lemuria spital ploughman emu wren shore bird coraciiform bird honey buzzard cuckoo dove family alcidae pinguinus impennis sea bird plautus alle razor-billed auk alca torda bird of prey triệu piciform bird night bird bird's foot caprimulgiform bird bird of passage peregrine falcon cuculiform bird bird watcher bird brain feather animal quail dove oligocene wade bird bird of paradise turtle dove old world flycatcher flightless bird bird table uropygial gland fly animal gallinaceous bird giana fragrans build nest syair menanti chesterford abhinava shahnaz bird strike snegurochka california pacificus moola guinea fowl two wing 2-8-4 ugali rock jumper al-sabah aquatic bird rátót lie egg whernside gongfu maligawa maryland congee somhairle drakon infestans apodiform bird ramshorn dagr ostara leighs rodeway batatas basal bristle vikrama chakkraphat tbl allsorts chi-ha peerlessly wolstan greyfield pu-erh bookham haseki pipi aswang okul alchemilla 0-4-0st thembu winge ægir ikh umoja al-jaber dermochelys al-ahmad latro kadambari alne daku brush turkey nks trango jonquil aynain auratus halh 358/2 bird of feather teia economos jutish lay egg ear tuft very light hydrotherikornis rare bird fly through air pleistocene ecology skuas willet mammal jaegers grebe kingbird pipit gannet phalaropes spoonbill sandpiper fulmar shearwater porpoise peccary honeyeater ursus woodrat otter iguanodon americanus saddleback oystercatcher robustus trilobite colobus chough shrike glacier mancallinae krill upwelling evolutionary pressure allozyme whimbrel avocet bufflehead jerboa greenshank turnstones moorhen merganser gyrfalcon insectivore haliaeetus redshank canid carcharias finback isopod eiders hellbender caracara indri balaenoptera curlew monotreme pochard goldeneyes biodiversity mitochondrial dna cytochrome b nucleic acid sequence purple gallinule golden plover barnacle goose canis lupus tufted duck lesser scaup aquatic mammal rusty blackbird cattle egret spiny anteater wandering albatross harlequin duck sparrow hawk reed warbler ocean sunfish ivory gull snowy egret arctic tern belted kingfisher pine grosbeak greater yellowlegs heath hen horned owl spotted hyena turkey buzzard chipping sparrow storm petrel ruddy turnstone brown creeper baleen whale theropod dinosaur elephant shrew glaucous gull western tanager vesper sparrow spruce grouse moray eel ursus maritimus roseate spoonbill scarlet tanager rhinoceros auklet horned puffin atlantic puffin cassin's auklet parakeet auklet whiskered auklet crested auklet guadalupe murrelet scripps's murrelet craveri's murrelet japanese murrelet spectacled guillemot pigeon guillemot black guillemot kittlitz's murrelet marbled murrelet long-billed murrelet ancient murrelet

Popular Searches

Words Related to auk

As you've probably noticed, words related to "auk" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "auk" are: great auk, razorbill, common murre, bird, and seabird. There are 456 other words that are related to or similar to auk listed above. Hopefully the generated list of auk related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like auk may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is auk?

Also check out auk words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of auk themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr