Bio Related Words

examples: winterunderstandingcloud

Here are some words that are associated with bio: biological, biotechnology, microorganism, recombinant, biocide, photobiology, biologic, biologically, bioscience, biology, biologist, ecological, microbiology, commensal, ecology, symbiotic, systematics, embryology, cytology, biochemical, neurobiology, organism, astrobiology, exobiology, biochemistry, haploid, cryobiology, radiobiology, xenobiology, diploid. You can get the definitions of these bio related words by clicking on them. Also check out describing words for bio and find more words related to bio using ReverseDictionary.org

Words Related to bio

Below is a list of words related to bio. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to bio:

biological biotechnology microorganism recombinant biocide photobiology biologic biologically bioscience biology biologist ecological microbiology commensal ecology symbiotic systematics embryology cytology biochemical neurobiology organism astrobiology exobiology biochemistry haploid cryobiology radiobiology xenobiology diploid metabolism agrobiology sociobiology paleobiology genetics genetic biogenic biotic dimorphism paleontology antibiological biophysics bacteria intercellular osmosis biogenesis
related words continue after advertisement
psychobiology neuroscience intracellular naturalist zoology conspecific organismal extracellular aerobiology histology bionanoscience phrenology polyploid physiology zoologist prokaryote gene scientific chemotaxis agronomy scientifically science dna protoplasm zygote bacterium unicellular biosynthesis saprophyte ecosystem anthropology taxonomic enzyme polymorph climatology biomolecular alchemical sociology proteid macrobiology pseudoscience eukaryotic environmental pleomorphism molecular biology metrology microbe geophysics electrochemistry activator multicellular pathogen lysis cytosol rna photoscience polymorphism eukaryote histochemistry life science taxonomy alga phytobiology geoscience subgenus cellular mutant glycoscience parthenote heterotroph biomolecule logy protist polygenesis biont evolutionary biology multiscience technoscience antiscience lifelore serology cytochemistry proscience scienceless sciencelike halophile myrmecophile cell theory heterologous in vivo superscience tribology free live chemical biology panspermy architectonics macroevolution chemotroph actinochemistry biolysis tectology subkingdom chemo zoochemistry heterology geophysiology microaerophile mcscience phytochemistry biospecimen lysosome zoöchemistry zooid mitochondrion bioacoustics natural history minicell tetraploid morphogenesis space biology acidophile cyberscience scientific discipline chemical ecology hard science slime mold organic chemistry topic category agro chemical biofuel biomedicine nanotechnology biomedical agri web biotech bioengineering organometallic nano pharmaceuticals carbonic sym cellulosic geo biodiesel ethanol chem zein virent sci biodegradable cellulose syn site nitrogenous biomass indu natural science system science type specie social science scientific theory cognitive science philosophy of science chemical physic somatic cell nucleic acid krebs cycle soil science artificial life exact science organic phenomenon genetic material peptide nucleic acid apply science school subject quantum physic physical chemistry stem cell ribonucleic acid biomimetics biocatalyst bioremediation bioconversion biochem morphic autotrophic fermentative cellulase haemo biogenetic petrochemistry admixing denaturant biocidal bioelectricity antitoxins bioenergetics live thing dichlorodiphenyltrichloroethane pharmaceutics frankenfood polyacrylamide bioterrorism radiochemistry proteinaceous agronomics metallocene acaricide guayule botulin biodefence propanediol salicornia lactide biohazards electrokinetic bioweapon teratology photoactive semiconductive siloxanes medicinals polycondensation borane polymerisation macromolecule repellants antitumour pharmacognosy voltaic cell fritz haber succinic acid methacrylic acid recombinant dna south carolina biological warfare antoine lavoisier zea mays horseradish peroxidase molecular sieve zinc chloride chemical warfare costa rica electron accelerator

Popular Searches

Words Related to bio

As you've probably noticed, words related to "bio" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "bio" are: biological, biotechnology, microorganism, recombinant, and biocide. There are 287 other words that are related to or similar to bio listed above. Hopefully the generated list of bio related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like bio may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is bio?

Also check out bio words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of bio themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr