Boils Related Words

examples: winterunderstandingcloud

Here are some words that are associated with boils: seethe, simmer, overboil, cook, bake, saute, skillet, abscess, churn, roil, moil, furuncle, change, obesity, boiling point, hair follicle, temperature, boil over, ferment, parboil, carbuncle, fever, broth, stirring, broil, saucepan, stew, braise, sear, thicken. You can get the definitions of these boils related words by clicking on them. Also check out describing words for boils and find more words related to boils using ReverseDictionary.org

Words Related to boils

Below is a list of words related to boils. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to boils:

seethe simmer overboil cook bake saute skillet abscess churn roil moil furuncle change obesity boiling point hair follicle temperature boil over ferment parboil carbuncle fever broth stirring broil saucepan stew braise sear thicken mixture cooking quarts sprinkle reheat cooked vinegar caramelize sauce infection puree browned grate deglaze overcook shallots undercook precook chargrill tablespoons kettle marinade folliculitis blanch frypan oven marinate pus stir fry
related words continue after advertisement
baste diabetes stye cellulitis malnutrition bacterium alter be move sizzle overflow turn roll modify strain enzyme boiling etna boiler steam stir tenderness parch soak gumboil decoct coddle poach fatigue coagulase drain salted boiled rinse cookery steamy grill chill boils percolation stove plaw fricassee melt roast soaking scald spoon melts garlic drizzle hot lyonnaise butter fry warm scraping thickens roasting gently coals discard thickened scrape irori cookware whisking cooker rage root brine dissolves syrup button whisk steamer pour creamed evaporates chilled recoct whipped steaming onions potatoes turmoil crispen broasted frying add barbecue whipping cornstarch evaporated juices pours frizzle bout rub sprinkling brushing melted juice naphtha dried heat skim griddle microwave range dough beans moisten drying reflux pouring dry pot hydronic sugar reserving moisture lemon simmering bubbling curdle evaporating dip wash soup cupfuls sterno casserole roux ladle tsp wok cooled submerge cookstove moistened carrots mushrooms concoct toast chef staphylococcus aureus culinary uncooked hibachi unbaked potholder human skin parfry boil food supercook uncook cookable brazier cooktop roaster saucy bacteria change state spill over staphylococcal infection bubble over ebullient braai sauteing cookpot staphylococci shirr lard prebake balti tenderization autoclave teleheating pastrycook souse boil point braising barbeque ladleful stockpot caramelise unpeeled tbsp stovetop refrigerate crockpot brined ecoli hoisin unmold cornflour macerate giblet zests undercooked grillmaster desuperheater superheat myiasis indigested organ system pustule swelter gallopin oil stove anemic rotisserie ready meal steam heater shiso immunodeficiency boil water lymph node cookmaid countertop oven soft boil heat food neoplasm multifunctional cooker alcoholism hematologic disorder grill steak candy thermometer barbecue food pan broil sunny side up pan fry brown meat steam condenser pot roast deep fat fry pressure cook peanut oil hard boil clean up kitchen measure flour intraoral dental sinus fry cook cook spray bone fish complication be appreciate steam boiler cook up measure ingredient mise en place bake off quarter chicken scarring au gratin hiv/aids food preparation pressure cooker stir pot steam room season dish hostess trolley burn food grill food well do kitchen timer bay leaf read recipe bouquet garni garlic salt chicken broth dutch oven caster sugar almond extract wine vinegar lemon rind bouillon cube orange rind garlic clove fever pitch steam power stick of butter deep fry bake oven town gas hoisin sauce extractor hood piece of coal chop vegetable kitchen hood cooker hood hot water haricot bean salt food skin cook book prepare meal prepare ingredient cordylobia anthropophaga raw meat create meal whip up rice cooker kitchen appliance risk factor brown bit follow recipe many food cook dish cook food tatty scone tatty cake slow cooker pudding basin medium rare range hood boil egg brain fry food creative account get ingredient olive oil boil hot cook utensil bake bread bacteremia kidney bake cookie diabetes mellitus fry pan have oven cookie sheet microwave oven toaster oven read direction cook off impress your date turn on stove heat water hot food burn yourself reflux condenser lymphoproliferative disorders immunosuppressive drug pneumonia antibiotic sepsis osteomyelitis endocarditis pimples atopic dermatitis impetigo spinal cord sebaceous gland toxic shock syndrome scalded skin syndrome food poisoning danger triangle of the face plastic surgery septic shock

Popular Searches

Words Related to boils

As you've probably noticed, words related to "boils" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "boils" are: seethe, simmer, overboil, cook, and bake. There are 415 other words that are related to or similar to boils listed above. Hopefully the generated list of boils related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like boils may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is boils?

Also check out boils words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of boils themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr