Cva Related Words

examples: winterunderstandingcloud

Here are some words that are associated with cva: apoplexy, stroke, cerebrovascular accident, album, attack, logbook, record, bookkeeper, register, audiobook, ledger, ep, cfi, blurb, lcr, pto, eal, chronicle, taa, stc, unrecorded, chanter, ild, etu, studbook, tas, videotape, ephod, registry, puran. You can get the definitions of these cva related words by clicking on them. Also check out describing words for cva and find more words related to cva using ReverseDictionary.org

Words Related to cva

Below is a list of words related to cva. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to cva:

apoplexy stroke cerebrovascular accident album attack logbook record bookkeeper register audiobook ledger ep cfi blurb lcr pto eal chronicle taa stc unrecorded chanter ild etu studbook tas videotape ephod registry puran recordable tape pentacle mixtape cassette numerus polygonum mtt mp3 yawl gramophone tro tarantella oeg glaive wcl quickstep videocassette archive lp registrar scrapbook songbook phonograph registration recorder disc camcorder vinyl fasti
related words continue after advertisement
cd fsd dpg yearbook workbook oaa enrolment audiotape vox annals enrollment owa 45 cartulary hymnal phonodisc haemorrhagic stroke ischemic stroke hemorrhagic stroke ischaemic stroke cerebral hemorrhage 78 tpd biography prerecord elv gsl bookkeeping recordless microgroove forbund neurorecording holography holorecording oscillogram kanun chromatogram telerecorded spirogram ippa bankbook booklist ijc bologram tapesponding 46-foot citu tsr-2 flipside lsh t-4 iais recordkeeper cashbook 14-meter jukebox tapescript bcu paleorecord historify oci profintern soundtrack frr asrc unfile potterholic memorabilia pottermaniac jmsdf sp 47-foot 700-ton cja seiðr gme cinefilm libelle videodisc aewa ftm palaestra kontra icpa omt vicarius bpf tica vekoma c-9 bdc bixi currach recordset awo nug icb uro four-character comco thüringer opo tapespondent ctbto icem photobook accession hkjc z-1 catalog fakebook ippf stimulus-response mtf l-4 cstc psalm recordkeeping design-build d'action federazione pno bmu stereogram pdrm bams soundex chod abab storybook baseplate jagriti end-blown lsr x-7 afe flexi disc history playlist registree potterite daybook reregister on book regest nonregistered parish register nonregistering photofluorography tapezine phonorecording sacrist epilog camcording autoregister sellotape telerecording radiocardiogram chronofile extelligence databook registerable autochanger semidocumentary lifelogging registrant jotterbook videomail scorebook photoguide passbook noctuary grangerize jotter psalmbook bookjacket chansonnier shopbook flipbook pneumatograph bookable midbook voicebank studio music postiller bookplate biblio fairybook grangerise phonograph record long play magnetic tape record album sound record tape record video record chromium dioxide on record world record luciferin cytosol guanosine dpp dehydrogenase peroxidase cyclization triphosphate chemotaxis transferase histidine quinone pheromone polypeptide mannose secretory efflux adduct uracil trypsin lyase tyrosine erk monoamine anionic threonine atpase hyphae vesicle re record record break for record flat file write record duct tape reel to reel find footage compact disk adhesive tape memory device book keep balance sheet musical score cd burner essential listen record somethign tape recorder b side on camera cross file paper trail song of song sex tape store information record player describe video commit point wide shoot spine tingler chemotactic plasminogen morphogen calmodulin midgut sphingomyelin cytidine esterase phagocyte thiols endosome basophils sensitizer avidin dephosphorylation exocytosis phosphoprotein tropomyosin herv dynein spectrin ouabain epithelia elastase oligomer proteinaceous secretase proteoglycan xenobiotic lysosome chlamydial mitogen glycolipid proteinase urease macromolecule hydrophobicity mononuclear microcapsule opsin plastid hapten peroxisome glycolipids pyrimidines ovalbumin cyto enkephalin thymidine nuclease ribonuclease palmitate depolarizing chromophore hydrogenase phenylene biomolecule somatostatin neuropeptide learn from register trademark data set time sheet historical fiction video camera financial record preparation table of content folk music publish ibt report news win post box set fun to read double book manorial roll sword and sandal be read black book neuromuscular junction sensory neuron adrenal cortex plasma membrane calcium ion adrenocorticotropic hormone epithelial cell horseradish peroxidase plasminogen activator

Popular Searches

Words Related to cva

As you've probably noticed, words related to "cva" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "cva" are: apoplexy, stroke, cerebrovascular accident, album, and attack. There are 400 other words that are related to or similar to cva listed above. Hopefully the generated list of cva related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like cva may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is cva?

Also check out cva words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of cva themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr