Egg timer Related Words

examples: winterunderstandingcloud

Here are some words that are associated with egg timer: egg, chicken, eggshell, cuckoo, omelette, yolk, henhouse, eggery, nit, ovum, hen, fryer, lactovegetarian, capon, chicken egg, poultry, chook, megapode, high in cholesterol, egg yolk, cockerel, chalaza, dominique, ey, rooster, battery cage, chickenhawk, lobster sauce, nonchicken, chickenless. You can get the definitions of these egg timer related words by clicking on them. Also check out describing words for egg timer and find more words related to egg timer using ReverseDictionary.org

Words Related to egg timer

Below is a list of words related to egg timer. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to egg timer:

egg chicken eggshell cuckoo omelette yolk henhouse eggery nit ovum hen fryer lactovegetarian capon chicken egg poultry chook megapode high in cholesterol egg yolk cockerel chalaza dominique ey rooster battery cage chickenhawk lobster sauce nonchicken chickenless chickeny good egg chickling junglefowl eggciting wimp chickenry lay chuckey halones roast chicken farm bird spring chicken chick broiler ovate rhode island red cowardly produce egg cowbird fowl pullet cobb salad
related words continue after advertisement
turducken avidin chicken coop chickenpox egg drop soup broody cock white meat bird's nest debeak roe strict vegetarian lay egg domestic fowl gamete paprikash mother hen pho baby bird meat chicken kiev male chicken vent peck egg white lie egg histomoniasis fowler nester bouillon ovulate egghot chicken leg quail bad egg plover vichyssoise quiche chicken soup wiener pheasant nest precocial sparrow taquito wildfowl coward cross road ovoid flightless bird coot wren mockingbird toucan albuminin eaglet magpie chickadee vireo trogon stork grouse puffin parmo ibis nightingale chickenshit chicken tender goose vulture swamphen petrel egg cell peacock spatchcock escabeche archaeopteryx ornithologist gosling thornbird flamingo guinea fowl starling anseriform birdling mousebird egg shape birdless birdlime giblet birdwatch birdwatcher shorebird gallinaceous bird twitterer grackle birdlet for bird birdish indigobird birder birdkeeper corniplume bowerbird birddom gibberbird birdfeeder chicken cordon bleu feather animal bird home shore bird brood parasite fuse brush turkey two leg coraciiform bird cuculiform bird clock bird of passage piciform bird bird brain caprimulgiform bird bird watcher wade bird hourglass clockwork sandglass celsius eggs inserted toothpick cookie refrigerator freezer rack dish spoon roasting microwave glue tube sandwich oven cake insert inserting bits omelet envelope implanting skewer bag needle popcorn clutch knife leftover cavity dough pie wrapper device spatula plastic canister embryo trays folding implanted candy mouse fridge screwdriver soup butter squab thermometer slice bake custard pod baking liquid jar scoop filling eats frying protein scrape thread scratch detonator foam wrap cookies crate drumstick potato cooked suction sperm slicing roast stuffed cubes pasteurized stick albumen pops scissors chunks plate pig pipe cheesecake bait chocolate cube fertilized slices milk blender bite ovalbumin pizza hatchery bird chickenability birdlike quetzal mcmuffin viscosity hatchling zabaglione denaturation jambalaya unfertilized quenelle wapanese flipping roaster frittata nidulant cooking waterfowl birdly heron partridge mallard birdcage scramble passerine sand min ding chicken breast chicken wing lowbell chef salad oilbird meatloaf waterbird birdbolt bobwhite spurfowl curassow anatidaephobia parrotfinch buy at store niçoise salad in oven icebox pie cad counting dozen ticked alarm beat two count tick snap beats reset old meter dial crater polls poll targeting notitia noses mustering muster mora lymphocyte list stops stop key incendiary splinter here haley fusing foul fillip enrolment enroll dud drive terrier shrapnel tea collate clout claw chuck chalk cbc catalogue bombshell bombard beads bead balloting balloons balloon azimuth alamogordo seven saturate run roster rolled retracted retract registered three pricking prick egg drop smap cratered leucopenia leukopenia orchotomy quartine airburst hourglasses aquatic bird bird's foot near water poach egg chou pastry water bird keyring referee's crease fetal age fertilization age linus torvalds near miss slit trench drummond light gestational age lymph cell blood test blood profile dead time fragmentation bomb intentional foul complete blood count differential blood count boiled eggs parking meter

Popular Searches

Words Related to egg timer

As you've probably noticed, words related to "egg timer" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "egg timer" are: egg, chicken, eggshell, cuckoo, and omelette. There are 424 other words that are related to or similar to egg timer listed above. Hopefully the generated list of egg timer related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like egg timer may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is egg timer?

Also check out egg timer words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of egg timer themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr