Fern Related Words

examples: winterunderstandingcloud

Here are some words that are associated with fern: vascular plant, bracken, leaf, horsetail, rhizome, pteridophyte, maidenhair, flower, plant stem, root, moss, species, brake, seed, spore, hart's-tongue, plant, gymnosperm, filmy fern, silvery spleenwort, ribbon fern, leather fern, silver fern, scented fern, holly fern, button fern, rock brake, flowering fern, hart's-tongue fern, golden fern. You can get the definitions of these fern related words by clicking on them. Also check out describing words for fern and find more words related to fern using ReverseDictionary.org

Words Related to fern

Below is a list of words related to fern. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to fern:

vascular plant bracken leaf horsetail rhizome pteridophyte maidenhair flower plant stem root moss species brake seed spore hart's-tongue plant gymnosperm filmy fern silvery spleenwort ribbon fern leather fern silver fern scented fern holly fern button fern rock brake flowering fern hart's-tongue fern golden fern new zealand gametophyte sporophyte equisetopsida bryophyte photosynthesis seed plant fern seed herbaceous spermatophyte clover frond cretaceous carboniferous pinnate
related words continue after advertisement
shrub spiderwort lycophyte sword fern maidenhair fern stolon fiddlehead fern leptosporangiate fern croton whisk fern ostrich fern orchid rhododendron genus phlox hibiscus euonymus holly asplenium nidus staghorn fern bottlebrush sensitive fern lycopodiophyta devonian osmund angiosperm clubmosses division diploid haploid chromosome ginseng sesame chloroplast lipfern lecanopteris wood-fern woodsia hay-scented davallia doodia scolopendrium fiddlehead woodfern filicopsida pecopteris spleenwort cliff-brake filicinae microgramma-piloselloides polypody sedum rhubarb cryptogam green chicory wort xylem hypocotyl bacopa seedling borage sporangia cloverleaf apomict salsify gromwell cotyledon asparagus epicotyl stickweed stem acrogen aeonium frog stapelia replant astrantia plantlet crotalaria monocarp reseda sunn myrmecophyte plantal soil thallophyte vegetal phyto phloem thistle liverworts sedge cassava wilding trefoil campylotropous perennial polypodiaceae hyssop herb triassic cress monocotyledonous cyatheaceae biennial phyte meadow daisy greenery shamrock warbler inula henbane botany botanical phylum acacia endemic pyrethrum senna saltbush microflora thallus phytotherapy plantibody insemination shrubs flowering manzanita pimpernel ovule lichen alkanet hygrophyte plantage soybean fennel sawwort lily parsnip lobelia fronds deciduous grasses birch chlorophyll neophyte willow brassica anophyte nasturtium saxifrage herbage cichlid plantlife thyme plantae angelica leech pickerel miterwort epiphytic lovage herbal orchids tabby grevillea understory planticle autophyte oilseed chestnut vine sporophyll antitranspirant peppermint catfish succulent cottonweed bark evergreen thrush lizard chickweed pieplant pennyroyal interplant hyla rootery foxtail tracheophyte darter flax bittercress wattle sorus quince rockfish gecko cyathea lupine tussock ferns eucalyptus blechnaceae bonney dioecious stalk zebra cichlids wisteria moth snake gentian polemonium bamboo hyena salamander marattioid fern lomariopsidaceae parrot serpentine asteraceae crow mantis gudgeon coralberry sunfish snail buttercup goby pillwort coniferous ophioglossoid fern phillyrea mussel pheasant mesofossil eucalypt cockatoo swallowtail class lilac potherb ranidae costmary boneset osmunda claytoniana pteris serrulata pityrogramma calomelanos hard fern cyrtomium aculeatum scolopendrium nigripes schaffneria nigripes asplenium nigripes scaly fern scale fern ceterach officinarum asplenium ceterach phyllitis scolopendrium narrow-leaved spleenwort asplenium scolopendrium bird's nest fern glade fern vittaria lineata pityrogramma argentea diplazium pycnocarpon grass fern solanopteris bifrons pellaea rotundifolia potato fern tongue fern pyrrosia lingua felt fern cyclophorus lingua cliff brake serpent fern hand fern rabbit's-foot fern doryopteris pedata polypodium aureum phlebodium aureum golden polypody microsorium punctatum climbing bird's nest fern snake polypody athyrium pycnocarpon lady fern coniogramme japonica drynaria rigidula bamboo fern basket fern strap fern lace fern bear's-paw fern aglaomorpha meyeniana cheilanthes gracillima umbrella fern sticherus flabellatus gleichenia flabellata lip fern fan fern giant scrambling fern diplopterygium longissimum class filicopsida class filicinae helminthostachys zeylanica grape fern adder's tongue fern adder's tongue water fern aquatic fern mohria caffrorum climbing fern pine fern anemia adiantifolia athyrium filix-femina wood fern spider fern shield fern buckler fern spider brake false bracken schizaea pusilla culcita dubia pteridium esculentum curly grass fern pteris multifida pteridium aquilinum pasture brake pteris cretica pityrogramma chrysophylla curly grass hay-scented fern gold fern todea barbara dennstaedtia punctilobula boulder fern king fern crepe fern todea superba prince-of-wales plume prince-of-wales fern prince-of-wales feather leptopteris superba crape fern tree fern chain fern bristle fern film fern nonflowering plant pityrogramma calomelanos aureoflava bladder fern athyrium thelypteroides rasp fern deparia acrostichoides gymnocarpium dryopteris oak fern thelypteris dryopteris gymnocarpium robertianum limestone fern northern oak fern matteuccia struthiopteris onoclea struthiopteris pteretis struthiopteris shuttlecock fern olfersia cervina polybotria cervina polybotrya cervina bead fern onoclea sensibilis canker brake polystichum aculeatum christmas fern dagger fern evergreen wood fern polystichum acrostichoides leatherleaf fern polystichum adiantiformis rumohra adiantiformis ten-day fern tectaria cicutaria indian button fern tectaria macrodonta oleander fern oleandra mollis oleandra neriiformis acrostichum aureum annual fern anogramma leptophylla jersey fern ornamental plant podophyllum ironweed barrenwort rutabaga stoneweed tracheophyta whitetop clade phytobiology bladderpod hawkweed underleaf stoneseed adiantum mayapple fanleaf wavyleaf sanicle coltsfoot comfrey rootlet ophioglossaceae biological life cycle muskroot mallis strobile fumitory goldenseal scitamineous plastid ophioglossum alternation of generations celeriac bloodwort glyoxysome knotweed sabadilla antiplant partridgeberry moonwort grape-fern bolete cartner plissken marattiaceae scoter ground-dwelling oldland dryopteris gourami clubmoss paey spikemoss grow in garden isoëtes cat's foot mountain mint habitat psilotaceae mountain norfolk island desert equisetaceae joe pye weed root hair seed leaf half hardy forest lion's ear bog swamp lion's foot grow in soil circinate vernation psilotales lamb's lettuce tree ophioglossales flower in spring poisonous plant equisetales marattiales mycorrhizal osmundales pea pod plant part evaporate hymenophyllales green leave gleicheniales bromeliad hydrangea honeysuckles barberry pot plant daphne oxalis glabra lonicera catalpa bellflower anemone plumbago berberis rugosa euphorbia lantana sinensis latifolia glauca ceanothus banksia mullein foxglove camellia myrtle dogwood acid hellebore gentians cinquefoil bayberry variegata grandiflora schizaeales fibrous root system salviniales limestone cyatheales winter aconite lipid polypodiales protein little gem arborvitae banana leaf calories lamb's quarter asplenium trichomanes carnivorous plant bullfinch hound's tongue azolla sea kale plant organ grow tall tobacco mosaic vanilla bean even primrose fern allies panama disease seed potato rattlesnake root turf daisy false foxglove hedge nettle sweet cicely plant in garden tassel flower leaf curl epiphyte bay leaf oceania runner bean guanches fern ally plumeria cotoneaster photinia ixora lysimachia ligustrum nandina dracaena paeonia turtlehead snowberry phalaenopsis cranesbill cordyline yaupon poinciana hippeastrum groundcover lagerstroemia heliconia winterberry shadbush tradescantia mandevilla trilliums waterlily toadflax liriope coleus vitex horticulture foliage weed gofio coal collecting textile pottery glass wood angiosperms arecaceae apiaceae metal midsummer finland oaxaca treasure printing sculpture rotorua flowering plant houseplant nephrolepis mosquito fern bird's-nest fern lygodium palmatum north america flowering shrub marsh marigold meadow rue trumpet vine pussy willow wax myrtle vinca minor kangaroo paw staghorn sumac acer palmatum bridal wreath asparagus fern butterfly bush skunk cabbage orchid cactus pampas grass sago palm red osier dogwood pteridomania tulip tree deciduous holly sweet alyssum sweet woodruff trout lily cystopteris bulbifera aarnivalkea gravestone european woodmouse new zealand lesser short-tailed bat cinnamon fern diplazium esculentum ptisana salicina canary islands licorice fern pacific northwest nitrogen fixation boston fern invasive species lygodium japonicum salvinia molesta victorian era fads and trends nature printing decorative art infant baptism wardian case the ferns of great britain and ireland flowering plants alois auer slavic folklore ivan kupala day fern flower will o' the wisp adiantum lunulatum ernst haeckel kunstformen der natur san diego, ca sequoia sempervirens santa cruz, ca franklin, virginia san diego

Popular Searches

Words Related to fern

As you've probably noticed, words related to "fern" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "fern" are: vascular plant, bracken, leaf, horsetail, and rhizome. There are 717 other words that are related to or similar to fern listed above. Hopefully the generated list of fern related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like fern may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is fern?

Also check out fern words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of fern themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr