Gsh Related Words

examples: winterunderstandingcloud

Here are some words that are associated with gsh: cysteine, glutathione disulfide, glutamate, glycine, protein, nadph, oxidative stress, bile, glutamate cysteine ligase, antioxidant, cell, peroxide, carboxyl, thiol, redox, animal, cytoplasm, tripeptide, electron, endogenous, cyanobacteria, proteobacteria, leguminosae, entamoeba, reactive oxygen species, giardia, free radical, halobacteria, lipid peroxidation, heavy metal. You can get the definitions of these gsh related words by clicking on them. Also check out describing words for gsh and find more words related to gsh using ReverseDictionary.org

Words Related to gsh

Below is a list of words related to gsh. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to gsh:

cysteine glutathione disulfide glutamate glycine protein nadph oxidative stress bile glutamate cysteine ligase antioxidant cell peroxide carboxyl thiol redox animal cytoplasm tripeptide electron endogenous cyanobacteria proteobacteria leguminosae entamoeba reactive oxygen species giardia free radical halobacteria lipid peroxidation heavy metal glutamate—cysteine ligase side chain amino acid heterodimer substrate molar concentration cytosol homodimer disulfide bond mitochondria
related words continue after advertisement
plastid metabolite gamma-glutamylcysteine paracetamol electrophilicity cofactor hydrophilic lipophilic microsome essential nutrient amino acids napqi glutamic acid sulfhydryl group proton donor acetylcysteine adenosine triphosphate leukotriene electrochemical gradient transport protein biotransformation methylglyoxal neurotransmitter glutathione synthetase reducing equivalent cadmium s-nitrosoglutathione peroxidase transferases px levels depletion concentration oxidation presence role addition concentrations conjugation reduction synthesis level reaction decrease loss effect amount increase absence regeneration amounts transport acid content ratio molecules release efflux functions determination pool turnover uptake gst enzymes availability metabolism excess supply doses biosynthesis compounds reduced oxidized depleted react plays reacts added deplete containing conjugated decreased synthesized oxidize protects converted regenerated measured serves involving regenerate appears reduce synthesize acts transported intracellular cellular hepatic total exogenous free red extracellular mitochondrial cytosolic phytophthora glutathione reductase neuromodulator glutathione s-transferase oxidoreductases millimolar cytochrome p450 oxidase sepsis phytochelatins chelate bioavailability atp ca ca2 calcium catalase cholesterol fdh hsm 1 adenosine adp amp arginine gssg thiols ascorbate depletes browning agglutination chelating must copper glutathione peroxidase glutaredoxin calcitriol cholecalciferol glyoxalase system calcifediol glyoxalase i glyoxalase ii lactic acid cachexia oxidized glutathione bimane nmda receptor tyrosinase pheomelanin dopachrome peroxides l-dopa eumelanin melanogenesis hyperpigmentation l-dopaquinone dithiothreitol bromobimane ampa receptor ionotropic receptor excitatory amino acid receptor glutathione-ascorbate cycle hydrogen peroxide pseudomonas syringae adenylyl-sulfate reductase sulfur assimilation salicylic acid s-adenosyl methionine ellman's reagent white wine in vivo oxidative damage grape reaction product caffeoyltartaric acid free radicals melanin synthesis hydrogen chloride buffer solution redox-sensitive green fluorescent protein confocal laser scanning microscopy high-performance liquid chromatography

Popular Searches

Words Related to gsh

As you've probably noticed, words related to "gsh" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "gsh" are: cysteine, glutathione disulfide, glutamate, glycine, and protein. There are 222 other words that are related to or similar to gsh listed above. Hopefully the generated list of gsh related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like gsh may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is gsh?

Also check out gsh words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of gsh themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr