Iff Related Words

examples: winterunderstandingcloud

Here are some words that are associated with iff: mathematics, biconditional, logical connective, xnor gate, material conditional, statement, logic, philosophy, file, mp3, formula, archive, unfile, accumulator, registry, directory, filename, register, registrar, registration, folder, fasti, inventory, record, unrecorded, podcast, autochanger, tapezine, tape, gramophone. You can get the definitions of these iff related words by clicking on them. Also check out describing words for iff and find more words related to iff using ReverseDictionary.org

Words Related to iff

Below is a list of words related to iff. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to iff:

mathematics biconditional logical connective xnor gate material conditional statement logic philosophy file mp3 formula archive unfile accumulator registry directory filename register registrar registration folder fasti inventory record unrecorded podcast autochanger tapezine tape gramophone ep camcorder chronofile fileserver chronicle recordable data format phonograph playlist enroll cartulary ledger videotape cassette videocassette reregister nonregistering database document nonregistered
related words continue after advertisement
registree regest recorder disc enrollment vinyl enrolment autoregister collator metadata flipside spreadsheet memorabilia storage savestate karyotype flat file holography accession telerecorded oscillogram tapespondent chromatogram videomail neurorecording holorecording recordless bologram prerecord lp textboard tapesponding registrant registerable paleorecord spirogram quipu phonodisc audiotape 45 recordset microgroove list bankbook enlist sp recordkeeper videodisc entry diskette appender computer file 78 tapescript voicebank recordkeeping stereogram historify noctuary telerecording filestore registerial data set savefile totalizator cinefilm steganography phonorecording sneakernet sellotape pathname truth table computerize biotelemetry photofluorography document folder lifelogging radiocardiogram befile payslip metalogic fbi igf forest bif bfa arf intergovernmental ifc fib forests forums forum sfi patients anc award diagnosis moscow cannes called also true complete equivalent valid idiopathic transitive text file book entry memory device xor gate reel to reel register trademark cross file cd burner triple bar record player for record on record world record tape record re record post up record communication paper trail phonograph record magnetic tape video record file system chromium dioxide write record win post hard disk disjunction mathematical logic ffi fii gpf ifi ipf zef wef sound record find footage file cabinet card index record break balance sheet record somethign long play b side wav digital camera financial record preparation duct tape 3d critique brigade glossary entire bt insightful bn instant fascinating int interesting keystone cryptography next dist corps contents conference nth battalion reg censored rev first diabetes fl 2d 47th april assignment av ave c compact disk core dump record album first-order logic audit trail commit point tape recorder box set single file scotch tape manorial roll screen motion capture financial statement general ledger personal video recorder mail merge foreign key store information videocassette recorder postage meter floppy disk sitekit cm town clerk propositional logic sex tape compass swing answer machine describe video punch card cd rom nail file blast from past chain of title time sheet dvd burner e ticket studio music data process criminal record parish register hold paper web server main memory log in epimorphism d. jan łukasiewicz truth-function exclusive nor logical system proof theory paul halmos necessary and sufficient conditions mathematical jargon domain of discourse john l. kelley

Popular Searches

Words Related to iff

As you've probably noticed, words related to "iff" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "iff" are: mathematics, biconditional, logical connective, xnor gate, and material conditional. There are 292 other words that are related to or similar to iff listed above. Hopefully the generated list of iff related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like iff may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is iff?

Also check out iff words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of iff themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr