Kafka Related Words

examples: winterunderstandingcloud

Here are some words that are associated with kafka: the metamorphosis, bohemia, prague, tuberculosis, contemplation, amerika, franz kafka, the trial, schoenberg, marcella, schumann, schindler, social alienation, the castle, kingdom of bohemia, austro-hungarian empire, a country doctor, max brod, letter to his father, zionism, heinrich von kleist, fantastic, bureaucratic, guilt, absurdity, a hunger artist, hyperion, german-speaking, author, writer. You can get the definitions of these kafka related words by clicking on them. Also check out describing words for kafka and find more words related to kafka using ReverseDictionary.org

Words Related to kafka

Below is a list of words related to kafka. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to kafka:

the metamorphosis bohemia prague tuberculosis contemplation amerika franz kafka the trial schoenberg marcella schumann schindler social alienation the castle kingdom of bohemia austro-hungarian empire a country doctor max brod letter to his father zionism heinrich von kleist fantastic bureaucratic guilt absurdity a hunger artist hyperion german-speaking author writer strakonice poděbrady yiddish holocaust gymnasium matura protagoras flaubert shechita osek mauscheldeutsch machine
related words continue after advertisement
lathe drill tolstoy asbestos mandatory palestine dowry sanatorium 20th century in literature goethe dostoyevsky literary realism novella mailer retells steinbeck hagiography existential anxiety turgenev bellow retelling octavo faust blume stoker werfel chekhov nietzsche liszt gunther proust dostoevsky frey diodorus vonnegut wieland franz bogdanovich talmud metamorphoses czerny stoppard czech republic eder mankiewicz dickens narrate benchley ephron narrates dracula stravinsky oeuvre friedrich snorri hemingway wittgenstein bartok ludwig strindberg orosius cather old town square ibsen orff insomnia rilke doris boden pinter plutarch shakespeare mesmer balzac forster polybius albee wolfe hedda anecdote reread preface brecht llosa bukowski gilpin asimov arndt poem ashkenazi jews epilogue expressionism dictaphone grimm blanchett coppola bernhardt streep wenner werner madeline richman silverstein cusack willem ebert krauss laszlo sabrina ingrid lucille hendrix caruso totten mendelssohn lombardo chastain zellweger ulrich haupt mahler pearlman albrecht marsalis caudle woodard cooley hammerstein aoki donato freund cornwell sauer molloy springsteen brice herzog schwimmer barrymore gabrielle weinberg gwyneth katharine mulholland hartnett sloane perlman brandi maxine macmillan pyle montag susannah josephine alpert stefani pavarotti schreiber halliwell martina hardie kline bloch coogan connery balfour clegg steadman begley zuckerman misha gaynor streisand ezekiel alyssa kalman felicia shaffer swenson western jackdaw standard german ottla kafka hiaasen łódź ghetto atheist bar and bat mitzvah carmina sagan kinský palace graal-müritz german charles-ferdinand university cartland didion felix weltsch hebrew semi-autobiographical yitzchak lowy däniken leaming hasidic judaism ludwig winder kesel naturopathy larynx the stoker oskar baum guralnick franz werfel hazan korbel vienna lidz hoving kopple bech ancient greek rosenblat book-length harbach foner sentimental education the temptation of saint anthony fyodor dostoyevsky hypochondriacal nikolai gogol antimilitarism seeger jankowski franz grillparzer anti-clericalism vermin blood brother czech literature torture johann wolfgang von goethe austria-hungary assicurazioni generali workers' compensation liblice personal injury work safety motif planing machine rotary saw peter drucker surrealism hard hat annual report bureaucracy klosterneuburg yiddish theatre reiner stach žižkov felice bauer the judgment letters to felice james hawes weimar czech language the zürau aphorisms milena jesenská letters to milena baltic sea gestapo dora diamant montessori education schizoid personality disorder borderline personality disorder joan lachkar university of munich anorexia nervosa sander gilman dante still life mixed media arthur miller jane austen don juan theater company dark horse hugo bergmann marxism peter kropotkin existentialism marx's theory of alienation modernism yiddish literature jewish peoplehood harold bloom pavel eisner dan miron the great wall of china julius guttmann hochschule für die wissenschaft des judentums parenteral nutrition new jewish cemetery, prague leopold ehrmann brazil asteroid barcelona vltava description of a struggle in the penal colony neue rundschau hunger artist josephine the singer, or the mouse folk absurdism elias canetti the new york times franz blei the aeroplanes at brescia kurt wolff before the law martin buber der jude prager tagblatt die neue rundschau prager presse rowohlt verlag die weißen blätter rené schickele verlag die schmiede berliner börsen-courier adalbert stifter literary executor gustav kiepenheuer verlag malcolm pasley university of oxford bodleian library marbach am neckar gerhard neumann s. fischer verlag esther hoffe national library of israel museum of modern literature w. h. auden vladimir nabokov gabriel garcía márquez thomas mann gilles deleuze schocken books félix guattari milan kundera surreal humour inquisitorial system adversarial system edwin muir willa muir secker & warburg alfred a. knopf the penal colony: stories and short pieces the first long train journey dearest father. stories and other writings ernst kaiser the castle, definitive edition, muir translation parables and paradoxes nahum n. glatzer the castle, critical edition, harman translation mark harman breon mitchell michael hofmann new directions publishing subordinate clauses in german jorge luis borges albert camus eugène ionesco j. m. coetzee jean-paul sartre josé saramago j. d. salinger best german novels of the twentieth century binghamton university george orwell ray bradbury patrick bokanowski the angel alex proyas film noir dark city roman polanski the tenant coen brothers barton fink the prisoner the twilight zone 3412 kafka asteroid belt randolph l. kirk donald james rudy palomar observatory apache kafka open source software stream processing franz kafka museum jewish museum new york city malá strana franz kafka prize franz kafka society old town san diego state university kafka project oceanic core complex

Popular Searches

Words Related to kafka

As you've probably noticed, words related to "kafka" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "kafka" are: the metamorphosis, bohemia, prague, tuberculosis, and contemplation. There are 439 other words that are related to or similar to kafka listed above. Hopefully the generated list of kafka related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like kafka may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is kafka?

Also check out kafka words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of kafka themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr