Laps Related Words

examples: winterunderstandingcloud

Here are some words that are associated with laps: knee, race, circuit, circle, lick, swish, overlap, lap up, swosh, lap covering, thigh, ride, pole, finish, podium, leg, straightaway, pit, backstretch, seconds, lave, wash, swoosh, hip, touch, touching, locomotion, travel, cuff, flap. You can get the definitions of these laps related words by clicking on them. Also check out describing words for laps and find more words related to laps using ReverseDictionary.org

Words Related to laps

Below is a list of words related to laps. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to laps:

knee race circuit circle lick swish overlap lap up swosh lap covering thigh ride pole finish podium leg straightaway pit backstretch seconds lave wash swoosh hip touch touching locomotion travel cuff flap lapel skirt pant trousers area arena domain field orbit sphere flow drink imbibe stroke tongue go sound lie laps biped turnup lappet schumacher raced rode barrichello comfortable villeneuve quickest finishing cart andretti massa finished coulthard clocked bike fastest
related words continue after advertisement
driver jumps vettel downhill ferrari straight riders wheel riding alonso driving earnhardt jimmie harvick clocking peloton biffle labonte mph montoya speed waltrip bumped stage brack kenseth jumping knock knocking racers bicycle rossi birdies halfway hamlin crashing jump skied drivers zanardi indy räikkönen kneeling sped sixth eighth fourth round fairway fifth ball turn bogey seventh overtook drove kahne knocked limo spin runners third stride christmas penultimate teammate races sprints rook car nose rider swing second ninth walk back belt erotic chew raikkonen rag length card legislative trick stupid circling tour abdomen pal tower journal ballot gift bosom strand abdominal animal fold welded plateau arm pace lap lap of honour victory lap cloth covering pair of trousers lap of the gods clothing licence newspaper sky return chik chee chek sal kart racer sprint speedway raceway backstroke racetrack chicane moto hairpin esses racecar servia hundredths dnf repass restarts tonio fittipaldi checkers gearbox 6-under hakkinen 5-under 4-under 7-under bogeyed lifebuoy wpi armco thousandths doorhandle mygale racecars dracone primat graining checkered flag pit lane flat tire san marinese hairpin bend le mans will power santa claus near competitive table underling floor the zones distance sec chest practice shoulder rep pocket giver interview open trip split hysterectomy stop secs playing stairs vip scarves pace bed spike lower delta press plate strip clubs lapghan stomache goodra lap dance laptop computer state university of new york sperm count

Popular Searches

Words Related to laps

As you've probably noticed, words related to "laps" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "laps" are: knee, race, circuit, circle, and lick. There are 267 other words that are related to or similar to laps listed above. Hopefully the generated list of laps related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like laps may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is laps?

Also check out laps words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of laps themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr