Megrims Related Words

examples: winterunderstandingcloud

Here are some words that are associated with megrims: aura, topiramate, depression, blues, headache, nausea, puberty, analgesics, ibuprofen, paracetamol, photophobia, osmophobia, caffeine, menopause, ergotamine, metoprolol, vertigo, ebers papyrus, brainstem, vapours, vapors, tension headaches, vomiting, neuroimaging, third trimester, hyperacusis, cerebral cortex, euphoria, fatigue, antiemetic. You can get the definitions of these megrims related words by clicking on them. Also check out describing words for megrims and find more words related to megrims using ReverseDictionary.org

Words Related to megrims

Below is a list of words related to megrims. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to megrims:

aura topiramate depression blues headache nausea puberty analgesics ibuprofen paracetamol photophobia osmophobia caffeine menopause ergotamine metoprolol vertigo ebers papyrus brainstem vapours vapors tension headaches vomiting neuroimaging third trimester hyperacusis cerebral cortex euphoria fatigue antiemetic triptan valproate delusion blue devils pallor prodromal malaise hemianopsia proprioceptive primary headache disorder axon phonophobia menstruation migraine treatment
related words continue after advertisement
pregnancy international headache society postdrome neuron cluster headache neurons exocytosis ancient egypt serotonin greek language propranolol autonomic nervous system menarche status migrainosus self-report scintillating scotoma tyramine field of vision scalp auditory hallucination triptans basilar artery brain stem biofeedback meningitis acephalgic migraine temple diencephalon orbit fever mental disorder major depressive disorder anxiety disorder medication overuse headache bipolar disorder single gene disorder familial hemiplegic migraine autosomal dominant ion transport cadasil syndrome post-traumatic stress disorder oral contraceptive attack know second trimester acupuncture papilledema monosodium glutamate indoor air quality divalproex aspirin trigeminal nucleus nerves gabapentin cortical spreading depression timolol aristides leão frovatriptan nmda receptor amitriptyline venlafaxine central nervous system narcotic migraine hemicrania gouts sensory nerve blood vessel dura mater pia mater accoutrements avocations remorse pangs pang accuser accusers pains ache aches affront agony pain alms apothecaries appellations auditoriums itch heartache cramp assassins brothers bailiffs assizes bakers bankruptcies attendants boroughs toothache blandishments sweat beaters barges sunburn smack scythe baptisms butterbur galen ergot child hippocrates tension-type headache opioid neurostimulator abdominal migraine cyclical vomiting syndrome benign paroxysmal vertigo of childhood temporal arteritis ergotamines acute glaucoma subarachnoid hemorrhage diclofenac mulligrubs metoclopramide barbers backache scaldfish bedchambers ketorolac sodium valproate olcegepant sumatriptan trepanation telcagepant barbiturate dihydroergotamine lidocaine haloperidol dexamethasone methysergide perimenopause first-line treatment angiotensin-converting enzyme inhibitor angiotensin ii receptor antagonist sick headache botulinum toxin spinal manipulation cognitive behavioral therapy transcutaneous electrical nerve stimulation migraine surgery non-steroidal anti-inflammatory drug cervical artery dissection william harvey ischemic stroke white matter calcitonin gene related peptide cgrp receptor antagonist nasal spray myocardial ischemia in vitro phase iii clinical trials transcranial magnetic stimulation aretaeus of cappadocia hormonal birth control cardiovascular disease

Popular Searches

Words Related to megrims

As you've probably noticed, words related to "megrims" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "megrims" are: aura, topiramate, depression, blues, and headache. There are 205 other words that are related to or similar to megrims listed above. Hopefully the generated list of megrims related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like megrims may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is megrims?

Also check out megrims words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of megrims themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr