Mir Related Words

examples: winterunderstandingcloud

Here are some words that are associated with mir: soviet union, international space station, spektr, space shuttle, mir core module, progress spacecraft, kurs, toru, sts-74, priroda, kristall, russian federal space agency, space shuttle atlantis, salyut 7, space station, zvezda, russia, kvant-2, elektron, kvant-1, valeri polyakov, tks spacecraft, mir docking module, extra-vehicular activity, vika oxygen generator, chemical oxygen generator, almaz, russian language, orbital decay, luch. You can get the definitions of these mir related words by clicking on them. Also check out describing words for mir and find more words related to mir using ReverseDictionary.org

Words Related to mir

Below is a list of words related to mir. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to mir:

soviet union international space station spektr space shuttle mir core module progress spacecraft kurs toru sts-74 priroda kristall russian federal space agency space shuttle atlantis salyut 7 space station zvezda russia kvant-2 elektron kvant-1 valeri polyakov tks spacecraft mir docking module extra-vehicular activity vika oxygen generator chemical oxygen generator almaz russian language orbital decay luch vozdukh proton-k salyut program soyuz spacecraft mir-2 buran program lyappa arm
related words continue after advertisement
france manned maneuvering unit tracking ship soyuz tm-17 george h. w. bush boris yeltsin microgravity research laboratory experiment biology physics astronomy meteorology proton rocket shannon lucid energia tonne buran immune system skylab progress russian volt ampere dorsum mir eo-28 etruscan khrunichev ukrainian cleanroom korean mongolian afrikaans spanish galician radio hispanic lithuanian telemetry slovenian soyuz t-15 bashkir swedish cambodian latium lira patois antenna austronesian danish dravidian norwegian latino balinese latin norse weightlessness estonian manchu xhosa moldavian soyuz tm-1 francophonie finnish albanian asturian breton latvian walloon oriya castilian myanmar italian berber portuguese french catalan indic hindi bulgarian serbian swahili lapp strela low earth orbit franco amharic artificial satellite romanian basque macedonian turkish altaic india arabic metis germanic belgian ampere-hour coptic ese frenchman occitan venetian slovene aleut pidgin human biology slavic egyptian cree eskimo italish spaniard dutch outer space astronaut frisian hungarian czech salyut programme slovak ru zulu lect german tsup wallonia language teutonic celtic labyrinth burmese orbital station-keeping armenian wolof hindustani semitic soviet space program scandinavian luxembourgian icelandic afar deorbit of mir bohemian teuton grecian yuri koptev deutsch lombard bilingual dialect lexis gaul arab skeleton carib greek multilingual slav bengali saxon vladimir chelomei bantu dane linguistic iranian english european flatulence s.p. korolev rocket and space corporation energia lingo iberian lithuania treadmill belarusian chinese baltic flemish launch vehicle serer germanism sango shoshone kilopascal hun galicia gaelic swede asian sanskrit catalonia linguist apache finn yiddish african aboriginal pyrenees protein valentin glushko argot fat central committee of the communist party of the soviet union carbohydrate limburgish 27th congress of the communist party of the soviet union jargon cognac europa cosmonautics day austrian 1984 vodka americanist eurasiatic baikonur cosmodrome europeanism sudovian syncretistic anatoly solovyev frenchism intralinguistic monoglot sabaean androgynous peripheral attach system spectrometer macrolanguage penglish interlanguage cyberlanguage utc+03:00 orbiter docking system space architecture salyut 1 syria salyut 6 afghanistan metalanguage sabellian slanguage bislama netherlander synthetic aperture radar sinicism mir eo-5 anglicism direct current dietitian nickel-cadmium battery soyuz tm-11 suzhounese extremophile atmospheric drag quail control moment gyroscope revolutions per minute gravity gradient soyuz tm-16 space rendezvous kazakhstan serbo croatian ultra high frequency cytokine caspase gene interleukin mrna phosphorylation enzyme methylation proteases oncogene receptor inhibitory kinase proteins exon histone phenotype aldosterone telomerase inhibition antibody tubulin androgens angiotensin mirs mitochondrial glucocorticoid antisense angiogenesis peptides murine tnf intron subunit vivo apoptosis glycoprotein lymphocyte mutations erk nicotinamide amyloid molecule prostaglandin renin ligand lymphoid dpp interferon astrocytes cysteine biogenesis eosinophils tau chromosome glycosylation ligase neutrophil actin fibroblasts phosphatase human language proto indo european ukraine micro-g environment romance language environmental control and life support system kiev atmospheric pressure baikonur indo european natural language pennsylvania dutch activated carbon atmosphere of earth pounds per square inch apollo 1 linguistic topic warsaw pact gyrodine space station freedom west germanic live language space race united states house of representatives afro asiatic auxiliary language low german space exploration dead language al gore, jr. viktor chernomyrdin artificial language shuttle–mir program national aeronautics and space administration 2001 space shuttle discovery standard language low saxon earth progress m-34 person with nationality moscow time amateur radio operators apas-89 mtor sunita williams arginase enos hif melanocyte cyclooxygenase osco umbrian acetylation polyamine ghrelin gastrin thymosin proteolysis monocyte centrosome autoantibodies tropomyosin osteoblast plasminogen heterochromatin catecholamine autoantibody catalase sarcosine mucin osteoclast aneuploidy spermatogenesis gluconeogenesis somatostatin ganglioside hematopoiesis muscle atrophy indo iranian spaceflight osteopenia latin american high german cardiovascular system ancient greek red blood cell physician perseids english plus stationary bicycle space toilet mother tongue locative case construct language sts-60 object language sts-63 british english language family mir eo-1 23 march sts-71 leonid kizim vladimir solovyov mir eo-2 sts-76 soyuz tm-2 yuri romanenko atmosphere aleksandr laveykin muhammed faris sts-79 abdul ahad mohmand jean-loup chrétien sts-81 mir eo-4 soyuz tm-7 soyuz tm-8 fiji nadi spacecraft drag houston coolant radiation gray chromosomal satellite lymphocytes immunity cataracts alexander viktorenko aleksandr serebrov english-american aleksandr kaleri sts-84 soyuz tm-9 mir eo-6 john blaha aleksandr nikolayevich balandin mir eo-7 soyuz tm-10 sts-86 mir eo-8 sts-89 soyuz tm-13 jerry linenger sts-91 soyuz tm-14 soyuz tm-25 michel tognini zarya soyuz tm-15 gene expression suppressor gene angiotensin ii amino acid messenger rna superoxide dismutase innate immunity endoplasmic reticulum progress m-18 soyuz-t mircorp igla soyuz-tm rorsat progress-m korolyov sievert progress-m1 micrometeoroid vbk-raduga meteor shower soyuz tm-18 sergei krikalev soyuz tm-19 soyuz tm-20 norman thagard soyuz tm-21 proton rocket apollo-soyuz test project mir eo-19 mir eo-20 mir eo-21 soyuz tm-23 mir environmental effects payload claudie haigneré soyuz tm-24 valery korzun soyuz tm-27 amateur radio orlan space suit vasili tsibliyev aleksandr lazutkin attitude control michael foale elena kondakova mir eo-24 flight engineer pavel vinogradov daniel goldin david wolf andy thomas nikolai budarin talgat musabayev gennady padalka sergei avdeyev soyuz tm-28 yuri baturin viktor mikhailovich afanasyev jean-pierre haigneré soyuz tm-29 ivan bella television studio movie studio soyuz tm-30 rkk energia cosmic ray south atlantic anomaly absorbed dose south pacific ocean equivalent dose jerry m. linenger background radiation wisconsin dells, wisconsin sergei zalyotin russian orbital segment fire extinguisher space debris rocket stage progress m1-5 mission control center project west ford short ton space exposure atmospheric reentry space shuttle orbiter satellite bus uncontrolled decompression progress 7k-tg

Popular Searches

Words Related to mir

As you've probably noticed, words related to "mir" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "mir" are: soviet union, international space station, spektr, space shuttle, and mir core module. There are 598 other words that are related to or similar to mir listed above. Hopefully the generated list of mir related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like mir may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is mir?

Also check out mir words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of mir themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr