Musk Related Words

examples: winterunderstandingcloud

Here are some words that are associated with musk: perfume, oxen, ox, muskox, gland, odor, scent, secretion, sanskrit, scrotum, fixative, perfumery, australia, scarab, base note, tibet, lectin, elon, india, spacex, eris, pakistan, bobcat, oryx, muscone, saputo, terrapin, musk deer, sloth, bovine. You can get the definitions of these musk related words by clicking on them. Also check out describing words for musk and find more words related to musk using ReverseDictionary.org

Words Related to musk

Below is a list of words related to musk. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to musk:

perfume oxen ox muskox gland odor scent secretion sanskrit scrotum fixative perfumery australia scarab base note tibet lectin elon india spacex eris pakistan bobcat oryx muscone saputo terrapin musk deer sloth bovine afghanistan peregrine xylene saker purina banta izzy china horse reindeer terrier aphid peeps agathon gummi nemi moschidae beef friis malted stag siberia karta cochineal grouse calla lek cart sika neem yak kist addo waziri duster ceres salz lotus
related words continue after advertisement
ymir wapiti mosque bergamot aroma chypre wistar spinelli fragrance sandalwood cologne aromatic jasmine lavender frankincense smell scents orris benzoin heliotrope angelica cassis camomile anise spearmint aloes carmine cassia prickle pollux wintergreen pennyroyal angora tannin pungency violets minty ambergris cinnamon orientals allspice pelage honeysuckle hyssop pheromones fruity lacquer caraway yamanaka cub weevils animal product torvalds frigg esau aster clover yogi hedgehog dung gummy sparrowhawk beanie mongolia hinze imogene wanandi tincture ilitch tsou man-eating cites north america statilius lovins reinsdorf boko horford chemical structure poaching shallah c-type teenie avci risebrough janjalani rabah gül siasia darner amalthea scrapie hirshberg blondy shox khadaffy stinkpot patchouli cedarwood vetiver neroli tuberose osmanthus perfumy garrigue resiny freesia redolence briary minnawi bearberry minni lemongrass lungwort cardamon monarda astringency boysenberry mustiness abelmosk winey woodiness pastille ceps silkiness limonene sloes puckery sauternes smokiness popeil ltt yamashina stonyfield mulee salsola halvorssen bokor synthetic musk muskrat organic compound traditional chinese medicine tonka bean eau de toilette vanilla orchid clary sage red currant black currant juniper berry orange blossom sweet woodruff limburger cheese cherry plum juniper berries cinnamon bark tannic acid gooseberry bush lemon balm bay laurel marsh marigold crocodile granular material cloaca tesla tbc fur other brad edison leeb trump powell tiel rogan jojo keanu wax gates stench the bolivia grimes siberian musk deer cosmetics detergent confection musk duck dirette tsla bezos musk shrew musk beetle african civet sternotherus odoratus american alligator abelmoschus moschatus angelica archangelica mimulus moschatus olearia argophylla endangered species calvin klein musk stick public domain encyclopædia britannica eleventh edition

Popular Searches

Words Related to musk

As you've probably noticed, words related to "musk" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "musk" are: perfume, oxen, ox, muskox, and gland. There are 267 other words that are related to or similar to musk listed above. Hopefully the generated list of musk related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like musk may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is musk?

Also check out musk words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of musk themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr