Ner Related Words

examples: winterunderstandingcloud

Here are some words that are associated with ner: poland, mab, afore, an, a, ae, n, łódź, ne, u, of, in, the, o, xor, for, thon, i, them, ette, myself, not, that, iv, from, neither, their, on, k, me. You can get the definitions of these ner related words by clicking on them. Also check out describing words for ner and find more words related to ner using ReverseDictionary.org

Words Related to ner

Below is a list of words related to ner. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to ner:

poland mab afore an a ae n łódź ne u of in the o xor for thon i them ette myself not that iv from neither their on k me per ar either nor b w those nand hers than which ab at into with him z therein j his f therefrom during non her v or who us towards since thereof l ye s therewith besides thereon um thereto my he thou therefore p yours thereafter hereto itself abc as and cor pronoun thereupon to d astern any y what
related words continue after advertisement
hereof ah whereon upon whereupon e whereof also alphabetic whereto you within xi whereas although batt herewith whereby it hereupon nothin hereafter whereat whereafter hereby therewithal wherefrom wherefore alphabet else r there one's americanization oh beth however hereunto moreover g none tns wherewith mu h against zeta but himself if bungo toward each then alphabetical thus otherwise au wherever she q abe dinner we aleph wherein c ler ter sah ich der suh vil rah ree zur dee ren zer gan mer dur pel ger mah tas leese lur mann soh doch ein vee bur tay ver denn sor ven nur kah sie dra ami nes tor kee mit bah nicht zee hah hur tion alles mun neu sel sar wir berg kahn kel ser bei tro stad chur meine ker nis nus ens unser lee hela cher lar aller dle kum ack vom sein ahn ral shay shem naught cox hither tau unspecified they thereagainst palochka athwartships alow inshipped whereinto it's m whereunder areach i've dystias i'm amerithrax thereinafter meot tamid tne tnm blee beh voo keh duhr ick droh ters reh t hereon mailboat so's monoclonal antibody roman alphabet blood type blood group out of s he spectral class warta river alpha privative scarlet letter hebrew alphabet in addition personal pronoun my ass latin alphabet cross ocean greek alphabet sail boat slovene alphabet as well russian alphabet geographic coordinate system

Popular Searches

Words Related to ner

As you've probably noticed, words related to "ner" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "ner" are: poland, mab, afore, an, and a. There are 295 other words that are related to or similar to ner listed above. Hopefully the generated list of ner related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like ner may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is ner?

Also check out ner words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of ner themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr