Ocd Related Words

examples: winterunderstandingcloud

Here are some words that are associated with ocd: anxiety disorder, trichotillomania, compulsive behavior, behavioral therapy, obsessive–compulsive personality disorder, genetics, stress, schizophrenia, mental illness, tics, psychosis, migraine, clomipramine, identical twins, child abuse, yale–brown obsessive compulsive scale, major depressive disorder, ptsd, atypical antipsychotic, bipolar disorder, generalized anxiety disorder, anorexia nervosa, bulimia nervosa, attention deficit hyperactivity disorder, obsessive–compulsive spectrum, striatum, serotonin, glutamate, mumps, suicide. You can get the definitions of these ocd related words by clicking on them. Also check out describing words for ocd and find more words related to ocd using ReverseDictionary.org

Words Related to ocd

Below is a list of words related to ocd. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to ocd:

anxiety disorder trichotillomania compulsive behavior behavioral therapy obsessive–compulsive personality disorder genetics stress schizophrenia mental illness tics psychosis migraine clomipramine identical twins child abuse yale–brown obsessive compulsive scale major depressive disorder ptsd atypical antipsychotic bipolar disorder generalized anxiety disorder anorexia nervosa bulimia nervosa attention deficit hyperactivity disorder obsessive–compulsive spectrum striatum serotonin glutamate mumps
related words continue after advertisement
suicide anthrax vd infection malaria scabies leprosy syphilis flu perfectionism mal heterosexual diabetes homosexual ill overdose influenza hiv gonorrhea idiosyncratic acne std malady diseased disease badly rabies arthritis typhoid dermatitis sickness emergency electroconvulsive therapy illness ebola zit eliza amputation worse pimple defectiveness excoriation botulism coping intrusive thoughts anxiety hand washing grey matter alzheimers tic disorders uncomfortableness pessimal undesirability lenticular nucleus caudate nucleus medial frontal gyrus anterior cingulate cortex eating disorders mutation dermatillomania selective serotonin reuptake inhibitors lyme disease hoarding mad cow disease pandas genital wart relationship obsessive–compulsive disorder dopamine ill health sexual obsessions dopaminergic be sick sexual orientation perseveration sexual identity adhd compulsive hoarding chicken pox case study tooth decay food poison heat stroke computer virus become ill have sore throat nail biting sexually transmit disease brain cancer get ill hsert stereotypic movement disorder head louse erectile dysfunction be ill get sick antibacterial soap skin disease feel ill brain tumor become sick cold sore exposure and response prevention feel sick have cold bad news migraine headache spider bite chronic disease oral cancer be worry go to hospitol spatial memory drink poison small pox get paper cut touch fire be uncomfortable terminal illness gray hair be rude be diseased live alone spoil food lose war be fearful be alienate be punish be greedy die alone unpleasant thing verbal memory be offend dirty thing become blind be scold smelly foot spoil meat be poor rotten fruit be betray be mistreat bad to bone break her leg grow stale be naughty be embarrass excessive heat bad skin be insane die in vain miss someone be under pressure be timid be exclude bad eyesight high tax eat bad food become poor be beat eat dog venereal disease starve to death no friend hairy leg eat dirt be snub break arm pollute air preferential treatment suffer fool be eat life of misery feel itchy be wound car wreck be infertile be irritate ingrown toenail light wind be delay toe jam bad tooth lose information be smother cold bath bad day lose argument be defenseless extreme cold be suppress overdo it be penniless be possess late fee break promise hear bad news be discourage be behead be fish french car be strand illegitimate child be dull be ostracize bad job be exhaust admit defeat be hang be overwhelm be confuse lose job bad music be leave out high cholesterol be crowd be square be shut legal problem be down be mistake low self esteem be cook be intimidate varicose vein have car accident be yell at bad food too much information be ignore verbal fluency test house fire break wrist be own file for bankruptcy small penis speed ticket ssri serotonergic cod knock social anxiety disorder cotransmitter toc psychopathology depression asperger epilepsy phobias hypochondria bulimia insomnia disorder autism syndromes neuroses eczema dyslexia affliction fibromyalgia psychopathy psychopathic addictions alopecia porphyria tinnitus tourette syndrome impulse asperger syndrome normality body dysmorphic disorder delayed sleep phase syndrome drug addiction dmos clinical depression psychoanalysis dco hypochondriasis scrupulosity symptomatology akathisia coprolalia schizophrenics enuresis dysthymia dysphoria hypomania depressives bruxism hypersomnia hyperhidrosis dyscalculia eoe prodrome compulsivity thyroiditis paraphilia anhedonia overactivity myoclonus alcoholics acrophobia neurofibromatosis arachnophobia adenoidectomy tmj proband parasitosis neuropathies agoraphobia habituation psychotherapy evolutionary psychology group a streptococcal infection psychiatric medication egodystonic antipsychotic self-concept egosyntonic self-image prefrontal cortex mesocortical pathway lesion basal ganglia dopamine pathway ventral tegmental area satan exorcism vitamin inositol nutrient fluoxetine risperidone quetiapine olanzapine orbitofrontal cortex aripiprazole psychosurgery 5-ht2a receptor serotonin receptor diagnostic and statistical manual of mental disorders social phobia antisocial personality disorder depersonalization disorder depressive disorder generalized epilepsy unipolar depression puerperal psychosis atopic eczema manic depressive illness essential tremor affective disorder retrograde amnesia lyme arthritis phantom limb pain eating disorder narcissistic personality hiatal hernia vesicoureteral reflux startle reflex temporal lobe epilepsy panic disorder kawasaki disease myotonic muscular dystrophy severe combined immunodeficiency restless legs syndrome clinical significance thought suppression n-acetylcysteine gabapentin tramadol hydrocodone cyp2d6 memantine topiramate mysophobia riluzole paroxetine lamotrigine cognitive behavioral therapy psychodynamic psychotherapy american psychiatric association scientific control social stigma exposure and response selective serotonin reuptake inhibitor tricyclic antidepressant cingulate cortex deep-brain stimulation vagus nerve stimulation brain tissue cognitive–behavioral therapy cognitive-behavioral therapy spiritual possession sigmund freud marc summers as good as it gets jack nicholson nutrition disorder mental disorder the aviator howard hughes μ-opioid receptor leonardo dicaprio matchstick men ridley scott nicolas cage samuel johnson retrospective diagnosis david beckham howie mandel deal or no deal here's the deal: don't touch me everything in its place

Popular Searches

Words Related to ocd

As you've probably noticed, words related to "ocd" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "ocd" are: anxiety disorder, trichotillomania, compulsive behavior, behavioral therapy, and obsessive–compulsive personality disorder. There are 437 other words that are related to or similar to ocd listed above. Hopefully the generated list of ocd related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like ocd may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is ocd?

Also check out ocd words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of ocd themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr