Ous Related Words

examples: winterunderstandingcloud

Here are some words that are associated with ous: ity, osity, th, ibility, icity, ness, ose, itude, craftsmanship, seamanship, adroitness, virtuosity, inability, incapable, showmanship, ability, competently, aptitude, capable, capability, able, hood, cleverness, workmanship, unable, messmate, shipboard, ship, flota, frigate. You can get the definitions of these ous related words by clicking on them. Also check out describing words for ous and find more words related to ous using ReverseDictionary.org

Words Related to ous

Below is a list of words related to ous. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to ous:

ity osity th ibility icity ness ose itude craftsmanship seamanship adroitness virtuosity inability incapable showmanship ability competently aptitude capable capability able hood cleverness workmanship unable messmate shipboard ship flota frigate salesmanship skiff proficiency competence topmast shrewdness topside dinghy craft togglability powerlessness affability dexterity craftspersonship mast skill prowess troopship skillful sloop whaleboat shipmate
related words continue after advertisement
foremast mayflower ar davit shipbuilder ableness robustness carrack prow mainsail competent galleon ingenuity yacht coracle flair muggle barque trimaran bonnet craftswomanship rudder motorboat hull harbor watercraft foresail lightship proa mainmast competency lugger forecastle shipload steamship scuttle sailboat capacity speedboat helm taffrail pirate originality susceptibility navigational faculty dhow resourceful powerboat quarterdeck schooner yawl selfhood ark stagecraft trireme shiply inshipped nonability undefeatability shiplike shipowning sive gener nus lish ble lar suc tant dus tal mense yur ery bla proprio joi weet bah fac dik har gest tro ster faut ull ine pronounced lui fil cul tous elle dar riv nal lik caus shipholder dismastment shipfic selfship fireship recognizability shiphandler ahull shipkiller foreship countability athwartships towship foxship reship artemon whaleship cocksmanship harborage mightly multihull lightvessel sealship tolerability shipworm cockleshell strongback unsailed monohull autohelm combinability boatable rhib mizzenmast wearability selfstanding enforceability boatmanship unbeatability supership shipling tjalk galleass motorsailer sailcraft bumboat ending system types danger ways forms groups problems studies kinds parts year reasons aspects solution examples efforts stages articles solutions consequences tissue combinations acid journal gallivat skute ribbie washability ious duh fal reat tch lightful ible domains sites users domain objects computers hierarchy other different separate multiple seri create created contain using creating applied nested linked curi abstemious chasm emulation clamorous passenger ship carvel build modern naval ship lubber's hole three decker poop deck hull down by steam ship rig square rig cargo ship mother ship stud sail midas touch surface watercraft jolly boat sail vessel cross ocean surface ship small ship accommodation ladder sail dinghy mean of transport rocket ship crow's nest jolly roger tall ship abandon ship dragon sail bilge pump patrol boat square sail sail ship cigarette boat -ite -eous -osity iodous fa la

Popular Searches

Words Related to ous

As you've probably noticed, words related to "ous" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "ous" are: ity, osity, th, ibility, and icity. There are 293 other words that are related to or similar to ous listed above. Hopefully the generated list of ous related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like ous may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is ous?

Also check out ous words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of ous themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr