Pcr Related Words

examples: winterunderstandingcloud

Here are some words that are associated with pcr: primer, dna melting, kary mullis, dna replication, dna cloning, dna sequencing, enzyme, nobel prize in chemistry, thermal cycler, dna polymerase, taq polymerase, thermus aquaticus, dna, phylogeny, gene, plasmid, nucleotide, molecular biology, dna sequence, hereditary disease, oligonucleotide, genetic fingerprint, forensic science, dna paternity testing, thermocycler, infectious disease, michael smith, amplicon, phage, chain reaction. You can get the definitions of these pcr related words by clicking on them. Also check out describing words for pcr and find more words related to pcr using ReverseDictionary.org

Words Related to pcr

Below is a list of words related to pcr. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to pcr:

primer dna melting kary mullis dna replication dna cloning dna sequencing enzyme nobel prize in chemistry thermal cycler dna polymerase taq polymerase thermus aquaticus dna phylogeny gene plasmid nucleotide molecular biology dna sequence hereditary disease oligonucleotide genetic fingerprint forensic science dna paternity testing thermocycler infectious disease michael smith amplicon phage chain reaction exponential growth formamide genetic engineering crp adenoma
related words continue after advertisement
csa tace mci pca hmg metastases aminotransferase acth mammoth mummy russia cosmid tsar complementary dna kilo base pair malignant thermoelectric cooling leukemia lymphoma lymphocytosis thyroglobulin chlorambucil cystectomy nadolol ascus fluvastatin adrenalectomy nephrectomy lymphopenia penetrance hepatectomy varices immunoreactivity seminoma orchiectomy neoplasia thyrotropin leukocytosis leucopenia proteinuria inotropic oophorectomy parathyroidectomy leukopenia cellularity pneumonectomy varicocele seroconversion metaplasia amenorrhea gastrectomy recanalization fluorouracil thyroidectomy amenorrhoea lymphadenopathy vasopressor neoplasm clomipramine carcinomatosis neostigmine curability arteriography hamartoma hepatoma leiomyoma albuminuria busulfan oestradiol sitosterol autoregulation osteoid thromboembolism nomogram isoproterenol hematuria hyperalgesia fibrinolysis stenoses hepatocellular triiodothyronine chlorthalidone monocytic colectomy carcinoid postop azathioprine pentoxifylline detrusor thrombocytosis indinavir thymectomy micronuclei hydronephrosis parasitaemia radiosensitivity hydroxychloroquine dysuria syngeneic mycobacterium agarose gel electrophoresis dna ladder virus in silico pcr hybridization probe southern blot northern blot biotechnology dupont escherichia coli genetic fingerprinting 16s rrna forensic analysis ancient dna thermophile promega endometrial carcinoma leydig cell axillary node malignant neoplasm serum albumin rheumatoid factor atrioventricular block erythrocyte sedimentation rate hepatocellular carcinoma prostatic adenocarcinoma richard iii gene expression quantitative pcr anaerobic organism tissue culture animal model viral load journal of molecular biology har gobind khorana california state route 1 scientific american dna double helix in vitro cetus corporation hoffmann-la roche emeryville, california

Popular Searches

Words Related to pcr

As you've probably noticed, words related to "pcr" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "pcr" are: primer, dna melting, kary mullis, dna replication, and dna cloning. There are 172 other words that are related to or similar to pcr listed above. Hopefully the generated list of pcr related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like pcr may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is pcr?

Also check out pcr words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of pcr themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr