Pigmy Related Words

examples: winterunderstandingcloud

Here are some words that are associated with pigmy: pygmy, mbuti, small person, australia, indonesia, philippines, aka people, india, andaman islands, southeast asia, binturong, central african republic, congo basin, republic of congo, anthropologist, thailand, malaysia, bolivia, brazil, negrito, efé, latin, dwarfism, homer, ethiopia, pejorative, bantu languages, ubangian languages, rainforest, central sudanic languages. You can get the definitions of these pigmy related words by clicking on them. Also check out describing words for pigmy and find more words related to pigmy using ReverseDictionary.org

Words Related to pigmy

Below is a list of words related to pigmy. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to pigmy:

pygmy mbuti small person australia indonesia philippines aka people india andaman islands southeast asia binturong central african republic congo basin republic of congo anthropologist thailand malaysia bolivia brazil negrito efé latin dwarfism homer ethiopia pejorative bantu languages ubangian languages rainforest central sudanic languages calcium rwanda burundi ethnic group uganda rattlesnake bayaka armlet central africa broadsword hawai veneno larrikin cameroon mitten
related words continue after advertisement
tendo lotos gabon zarah songes tiamat quahog mignonette conch buckaroo grupa angola styrian sucia coppers botswana namibia madagascar zambia papua new guinea twa szechuan ding-dong wheatgrass klapa blackcap massasauga khasa goldstar ameiva fafner ancient greek junonia bangus suzu tam-tam cook-off charaxes good-humoured zajick amberjack badak m-flo cullercoats opah chonaill huaqiang srebrna greek mythology sancocho mirch cobia kontakt kaliya athleta porites ringneck llanthony sportsground gramma hippopotamus yma panax longyi phonic holey bahamut battle-axe belacan cornershop paphiopedilum sriracha slobbery lipsticked gleek ricercar dolora invermere tanuki mahari budrus buaya cloudberry koneru kushti gumboot monarda pelophylax lolol baxi essingen bhari mabuya pansori shansi peigan round-leaved damselfish choucroute touché yangge polystichum cobwebby baka people hunter-gatherers twa peoples kongo language ultraviolet light khoisan vitamin d bbc spoonbill titi tarsier wagtail robustus indicus hippopotami auks loach peccary cassowary muntjac mandrill colobus africanus nightjar kinglets skink butterflyfish loris pipit duiker lubber ursus caracal bulbuls cichlid fossilised bisons hornbills quoll argus growth hormone receptor cannibalism growth hormone magic insulin-like growth factor-1 hunter-gatherer andamanese democratic republic of the congo equatorial guinea slaves unicef macaronies sifaka bushbuck hyrax mongooses geochelone bandicoots bettong domesticus morepork jerboa guenon simians mynah insectivore babirusa tusked kudus crocodylus rhinocerous canid hooved lechwe serow redshank avians gaurs aardvarks chaffinches platypuses whiptail jabiru haliaeetus guanacos mantids batak aeta mbenga people interahamwe ituri rainforest great lakes twa african great lakes rundi language kiga language late stone age flores african rainforest vanuatu burma endogamous tibet relict china yunnan cairns palau fiji queensland aka language semang baka language uniparental marker proboscis monkey rock hyrax sparrow hawk reed warbler legless lizard slow loris giant tortoise canis lupus stag beetle maned wolf panthera pardus striped hyena fiddler crab komodo dragon slender loris jungle fowl spotted hyena tufted puffin elephant shrew theropod dinosaur nile crocodile spiny anteater wart hog meadow vole colocasia esculenta wandering albatross myna bird gray catbird mynah bird second congo war steatopygia un security council proto-australoid crime against humanity genocides in history t'rung tibeto-burman international criminal court movement for the liberation of congo 1994 rwandan genocide bantu peoples simha arom congo free state the lancet malay peninsula dark skin spanish language recent african origin of modern humans great coastal migration cairns, queensland homo floresiensis derung people viti levu hkakabo razi edward winslow gifford east asia djabugay people new hebrides espiritu santo homo sapiens

Popular Searches

Words Related to pigmy

As you've probably noticed, words related to "pigmy" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "pigmy" are: pygmy, mbuti, small person, australia, and indonesia. There are 316 other words that are related to or similar to pigmy listed above. Hopefully the generated list of pigmy related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like pigmy may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is pigmy?

Also check out pigmy words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of pigmy themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr