Pink Related Words

examples: winterunderstandingcloud

Here are some words that are associated with pink: red, rose, dianthus, color, purple, pinkish, carnation, magenta, yellow, blue, flower, chromatic, fuchsia, lavender, carotenoid, multicolored, carmine, orange, pinko, white, go, sound, pastel, mauve, solferino, gillyflower, colored, violet, knock, rap. You can get the definitions of these pink related words by clicking on them. Also check out describing words for pink and find more words related to pink using ReverseDictionary.org

Words Related to pink

Below is a list of words related to pink. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to pink:

red rose dianthus color purple pinkish carnation magenta yellow blue flower chromatic fuchsia lavender carotenoid multicolored carmine orange pinko white go sound pastel mauve solferino gillyflower colored violet knock rap tap lipstick colorful chromatic color reddish garden pink flamingo india odyssey homer latin cimabue duccio raphael lilac shiny green purplish pink striped scarlet turquoise gray crimson madonna of the pinks virgin mary iridescent indigo sequined madame de pompadour
related words continue after advertisement
hibiscus louis xv of france george romney purply emma, lady hamilton horatio nelson thomas lawrence myoglobin cochineal elsa schiaparelli salmon pink sheila levrant de bretteville brazil astaxanthin utah ping eroticism seduction rayleigh scattering verb bolivia eos lucretius dawn florid collectivist leftist apricot peach cut coral rococo rosy bacchante springtime sinopia rosiness pinkness left-winger surrealist serifos delphinium orchid homosexuality roses cornflower satin shades hair black jacket paint larkspur shirt bright broadside wallflower dyed wore dark velvet coloured maroon colors redden flowers bicolour aluminium rosa ribbons rosepetal blush silvery shirts wears ruddy snapdragon grey socks sported suede coat stripes adorned logo worn hats golden dresses wearing jasmine dress rouge pants embroidered hat poinciana nigella brightly leaf patch painted henna blouse oversized ribbon pigment clad bearing roseate blossoms soft redness shorts tuxedo dolls sleeve daffodil patterned neon gules lips thick shaped blond covered sunflower tops shade pale draped denim shrimp patches skin jeans glow mask feathers andhra pradesh boots petal signature skirt floral brightness saturation vermilion flowering plant efflorescence tulip dandelion pinking shears bloomer salmon sienna hue bloom redly lily sunrise attar reddy blossom flowery sunset asteraceae daisy alaska colour cyan poppy bicolor corsage rubicund epic poetry cyclamen de rerum natura topaz gridelin corundum dyc incarnadine tanzania calcite floribunda morocco red flower barite china pink button pink rainbow pink dianthus caryophyllus clove pink sweet william dianthus barbatus genus dianthus dianthus chinensis grass pink dianthus deltoides fringed pink yellowish pink dianthus plumarius dianthus supurbus maiden pink spectral colour spectral color chromatic colour cottage pink cheddar pink dianthus latifolius diangus gratianopolitanus venetian red misty rose cennino cennini yellowtop some flower turkey vexillar amaranthine antired ruddiness geru t-shirt rose colour erythrophyll rubify toyon dominica sevres porcelain raspberries viscidium spirea fleshcolored petaloid redward redwards efflorescent orthochromatic species trichromatic argaman nanoflower flowerful reflower calceolaria cineraria effloresce bloomly polychromatic gynantherous heterogony blimming centaury florigenic bepurple rebloomer rosaniline bloomy colorize zinnia blossomest maurice quentin de la tour rebloom aflower orinoco floret coneflower flowerlike argb colorous coloristic decolour homogonous biflorous recolor uncolorable chasmogamy multiflowered uncolored cyanotic reblossom pseudanthium florally blossomy queen victoria peru red tide claude monet ecuador colombia red valerian princess francisca of brazil basil balm venezuela rhodochrosite princess of joinville franz xaver winterhalter clinochlore albino jean cocteau pig shocking pink melanin mae west nazi germany nazi concentration camps plankton pink triangle gay rights movement dwight d. eisenhower florida rose color mamie eisenhower pastel color funny face red violet australia beef woman's building vertebrate christo and jeanne-claude protein biscayne bay franz west iron ham jacqueline kennedy john f. kennedy brown lacy taupe tangerine frilled aquamarine beige hued fleecy periwinkle cerise puce pearly mona lisa bright color crustaceans american institute of graphic arts crabs marilyn monroe lobsters gentlemen prefer blondes attar of rose orange blossom blue red red fescue primary colour many plant primary color tints and shades pleasant smell grow in pot variations of pink pollination creep jenny blood red azo dye atmospheric particulate matter straw color blue flower clematis in bloom gold ochre african daisy sulfur color in flower prairie rocket sweet sultan my car incomplete flower cotton rose rose of sharon brass button flower basket blue daisy heather mixture globe amaranth easter lily olive color guernsey lily colour of rainbow tulips peach blossom yellow rattle benedict's solution brick red butterfly flower red blue colour in colour television santa monica cream color dahlia oxeye daisy late bloomer flesh color christmas bell love in mist peony prosciutto ouro preto magnolia rhododendron sparkly oxblood ecru pearlized loden stripy stonewashed goldish florescent orangy orangish strawflower bronzy bicolored glittery nubbly tightfitting sueded pearlescent rhinestone tannish shagreen nubby splotched hyacinth guangxi zhuang autonomous region bice erzerum province coral pink sand dunes state park saffron navajo sandstone zion national park spring great santa cruz island philippine islands west indies sandstone antennarius ocellatus anthocyanins east timor pink iguana galapagos islands agra pradesh amazon river dolphin river dolphin akbar amazon river araguaia river tocantins river kannur moscow raspberry strawberry rosé canada malaysia namibia caboose toy edmonton gender burma hawaii honolulu macau cherry yangon alberta champagne provence endangered species white elephant southeast asia laguna colorada roseate spoonbill myakka river state park lophochroa leadbeateri sodium nitrate sodium nitrite lime green canary yellow polka dot mary janes eau de nil mandarin collar cobalt blue purplish blue kelly green broderie anglaise coral necklace burnt umber navy blue purplish red daisy duke cerulean blue indigo blue glen plaid romper suit spaghetti strap suspender belt pinafore dress yellow ocher burnt sienna duster coat dolman sleeve reddish orange reindeer moss toreador pants pale violet nail polish bob wig patent leather ultramarine blue nitric oxide fluorone post-modernist bandol macaron erythrosine egg yolks roast beef moscow state university spiraea japonica prunus serrulata phlox paniculata thomas jenner william salmon venetian ceruse malbork castle teutonic knights agra fort mughal empire casa rosada buenos aires ostankino palace pyotr sheremetev macau government headquarters pombaline style breast cancer awareness month model train baby blue coal car steam locomotive freight train lionel trains world war i chi chi dango national breast cancer awareness month dactylopius coccus allura red ac organoiodine compound food coloring la gazzetta dello sport giro d'italia canada place atlanta, georgia georgia-pacific tower waikiki beach pink news road bicycle racing royal hawaiian hotel national congress of brazil breast cancer pink ribbon financial times herero people mugdha godse cotton candy

Popular Searches

Words Related to pink

As you've probably noticed, words related to "pink" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "pink" are: red, rose, dianthus, color, and purple. There are 634 other words that are related to or similar to pink listed above. Hopefully the generated list of pink related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like pink may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is pink?

Also check out pink words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of pink themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr