Pus Related Words

examples: winterunderstandingcloud

Here are some words that are associated with pus: inflammation, exudate, abscess, festering, suppuration, purulence, sanies, ichor, pimple, pustule, mucus, secretions, phlegm, bile, hematoma, sores, feces, abscesses, glands, cysts, macrophage, faeces, excrement, gunk, goop, pansa, fluid, infection, humor, humour. You can get the definitions of these pus related words by clicking on them. Also check out describing words for pus and find more words related to pus using ReverseDictionary.org

Words Related to pus

Below is a list of words related to pus. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to pus:

inflammation exudate abscess festering suppuration purulence sanies ichor pimple pustule mucus secretions phlegm bile hematoma sores feces abscesses glands cysts macrophage faeces excrement gunk goop pansa fluid infection humor humour epidermis gleet protein leukocytes vertebrate oozing amniotic coagulated congealed neutrophils cerebrospinal stasis puddles squirting bleeds blisters quicklime spurting autologous whitened watery gages clumps gastric
related words continue after advertisement
saliva platelets secrete seepage serous heaving hemorrhoids gums wadis muck clot drips yellowing dripped furrows nodules achenes lymph maggot spattering droplet heartbeats condensation secreting droplets pores duct silt thinning caked pepa oleum dripping undergrowth fluids rivulets transfused cavities coalescence oily lather cistern filtrate varicose capillaries veins perspiration ooze armpit memorie glucoside cytokine chemotaxis body fluid bodily fluid liquid body substance hindu calendar hindu calendar month non-newtonian flab splatters haemolymph thrombophlebitis rhizobia scrotal rbcs extravasation fasciitis lusi three-lobed bedsores melena phagocytosis myelodysplasia neutrophil leukocidin immune response amoeba plutonium whitehead bursa anus goo aspirate intestines sac swellings nares poo conjunctiva vomit cloaca integument vagina lymphatics excreta pleural ulcer pericardium vulva protoplasm maggots rectum nostrils spleen fontanelle udder mucosa myeloperoxidase liver bacteria pyocyanin aphorism white blood cell diverticula blackhead smegma styes granuloma bleb vomitus meconium epiglottis seborrhea papules afterbirth putrescence hydrocele interdigital comedones bronchioles nidus hemangioma meninges telangiectasia inflamation exudates volvulus carboy pinworms osteomyelitis streptococcus boil psoriasis pseudomonas aeruginosa impetigo atomic number 94 abdominal cavity pericardial sac fecal matter granulation tissue anal canal cerebrospinal fluid pleural cavity chest cavity ingrown hair peritoneal cavity vaginal discharge lymph gland mucous membrane amniotic sac sebaceous cyst nasolacrimal duct fibroid tumor tear duct vitreous humor meibomian gland nasal cavity faecal matter staphylococci asepsis latin language ubi pus, ibi evacua septic arthritis sir frederick treves, 1st baronet necrotizing fasciitis

Popular Searches

Words Related to pus

As you've probably noticed, words related to "pus" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "pus" are: inflammation, exudate, abscess, festering, and suppuration. There are 225 other words that are related to or similar to pus listed above. Hopefully the generated list of pus related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like pus may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is pus?

Also check out pus words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of pus themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr