Rank Related Words

examples: winterunderstandingcloud

Here are some words that are associated with rank: status, grade, place, position, order, rate, rank and file, level, uniform, lieutenant, hierarchy, brevet, infantry, earldom, ranking, dukedom, subordinate, prioritize, military rank, second class, sixteenth, organization, sixth, sheer, range, flagrant, membership, absolute, egregious, crying. You can get the definitions of these rank related words by clicking on them. Also check out describing words for rank and find more words related to rank using ReverseDictionary.org

Words Related to rank

Below is a list of words related to rank. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to rank:

status grade place position order rate rank and file level uniform lieutenant hierarchy brevet infantry earldom ranking dukedom subordinate prioritize military rank second class sixteenth organization sixth sheer range flagrant membership absolute egregious crying gross glaring downright gradation ninth military right-down out-and-out outrank seventh eighth princedom eleventh station general social station social rank social status abundant offensive fertile conspicuous complete
related words continue after advertisement
rating war paygrade conscription class legion command army distinction regiments regimental elite seniority battalion echelon colonel classification lieutenant colonel physical fitness country defense enemy weapon seventieth come sixtieth judge evaluate fiftieth fortieth thirtieth twentieth nineteenth eighteenth seventeenth fifteenth fourteenth upgrade thirteenth twelfth excel downgrade tenth fifth surpass fourth third second first quality sequence line seed organisation body personnel force shortlist viscountcy kingship barony baronetcy be step tier last millionth thousandth hundredth ninetieth eightieth vehicle aircraft ship engine clothes prioritise reorder superordinate billionth archidiaconate viscounty camouflage brigadier forest ranks assigned assumed commanding desert generalship highest distinguished law commanded corps regiment midshipman enrank cadet generality cavalry duty retained assuming promoted admiral division 3rd given 4th insignia 5th chosen subaltern imperial hierarchical strength badge adjutant enlisted 6th nominal positions 8th 2nd battalions honorary brigade placed represented 7th 1st assume remainder veteran equal nco member duties honours ranker overall appointed 9th dignitary relative thus awarded equivalent provisional retain lieutenancy knight terms individual served junior numbers selected consequently consisted represent merit regular honor category platoon honorable commodore lowest non-commissioned hede number one come out armed forces end man war machine armed services military machine come in enlisted man pass judgment military rating stand out disrate quinary downrank marshal mercenary hade quaternary stewardship octonary lieutenant-colonel senary nonary krill warlord emplacement headquarter militaristic i.e. militarily australia tensor wardroom regimentals occupier expeditionary taxonomy cadetship sapper four-star generalization paratroops high-ranking grader clade outpost musketry regnum bangladesh conscript navy sortie redoubt preceptorship unarmored phylum militia canada classify garrison officer taxon septenary france iron eagle commandership second lieutenant declass hungary chieftaincy nonmilitary premilitary militaresque hutment antimilitary noncombatant counselorship disordinal unmilitary fianchetto draftee india militaria high up milab obvious rankings rungs percentile among percentage top esteem middling emoluments scores sergeants demotion boast list morale corporal privates valor salary earners agreeableness grievance dan petty brass castes platoons superiors average cadre dregs regt generals standings adjutants tiers decile gallantry squadrons ladder levelism narcomilitary first lieutenant reformado group captain commandwide italy taxiarch flag officer brigadier general vigenary lieutenant junior grade japan strategus order of precedence malta tactical realism ex cathedra warrant officer lieutenant general first mate major general quintile quartile centile efg incarcerator reenlistment stingiest noncoms raoc general officer commission officer slovenia execute order special forces hill station upper class command post commission military officer bottom order commission naval officer flag rank lieutenant commander military unit military officer high rank military post spain army officer zoological nomenclature staff officer military installation national guard armor personnel carrier navy yard noncommissioned officer field marshal military reserve mess hall military quarter executive officer high command muster roll chief petty officer air force full dress uniform naval officer inspector general sky marshal high level b 52 general staff drumhead court martial armor car military uniform west point senior captain argentina captain of industry whooper swan basic train military ceremony stand army mass of maneuver army intelligence fighter pilot rifle training weapons exercise parade form taxon military science high profile army engineer air base air marshal fleet captain socio economic class line of battle adjutant general psychological operation keep peace work class military service naval unit amphibious operation combat pilot field hospital fire line merchant marine pecking order batting average dishonorable discharge per capita new zealand saudi arabia south africa united kingdom first aid united states

Popular Searches

Words Related to rank

As you've probably noticed, words related to "rank" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "rank" are: status, grade, place, position, and order. There are 470 other words that are related to or similar to rank listed above. Hopefully the generated list of rank related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like rank may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is rank?

Also check out rank words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of rank themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr