Sleep Related Words

examples: winterunderstandingcloud

Here are some words that are associated with sleep: awake, dream, insomnia, nap, rest, kip, rapid eye movement sleep, bed, melatonin, slumber, caffeine, coma, hibernate, hibernation, narcolepsy, slow-wave sleep, night, life, wait, sleep apnea, quietus, stimulus, nightmare, homeostasis, mammal, eternal rest, eternal sleep, stress, adenosine, sleeping. You can get the definitions of these sleep related words by clicking on them. Also check out describing words for sleep and find more words related to sleep using ReverseDictionary.org

Words Related to sleep

Below is a list of words related to sleep. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to sleep:

awake dream insomnia nap rest kip rapid eye movement sleep bed melatonin slumber caffeine coma hibernate hibernation narcolepsy slow-wave sleep night life wait sleep apnea quietus stimulus nightmare homeostasis mammal eternal rest eternal sleep stress adenosine sleeping circadian clock physical condition physiological condition physiological state unconscious asleep death therapy beauty sleep wakefulness paralysis narrative rem hold brain bedtime prolactin breathing sleep cycle
related words continue after advertisement
sleep disorder non-rapid eye movement sleep pain immune system circadian rhythm sleep disorder stay lie crib waking get idle fish actigraphy park mental standby shower off breathe shutdown snoring eating suspend eye healing artificial light slept you burn can child growth hormone eat coffee glycogen cerebral cortex day pineal gland ibuprofen consciousness animal human sopor muscle anabolic period bundle accommodate admit sleepwalking birds reptiles dyssomnia hypersomnia amphibians doze nrem shut-eye shuteye catnap aestivate estivate snooze parasomnia bruxism catch some z's log z's thalamus bunk torture hormone electroencephalography stimulant bedding sedation electrooculography hibernating electromyography bedroom person lullaby entrainment resting dying polysomnography apnea staying electrocardiography breath numb patient sick sickness inactivity accommodation cortisol sex sleeper normal dormancy kiss lying hump twinkle sunset treat patients sedate recess voluntary muscle adjournment retire threesome heart crying seduce reprieve waiting discontinuation symptoms exhaustion harry people crash reads inactive childbirth hanger babies disorders of consciousness blood deprivation endure stomach dodo children doctors sor kids weather waiver sors nervous treating moratorium yourself illness standstill treated suspension induced bleeding hoped suspending drinking suspended discontinued mind hours trauma room layer my listening lungs discontinuance treatment whenever eze sleepin slp balancer derogation grasse sum physical snore sleepiness wakeful drowsy couch mothers depression heartbeat survive healthy happens your habits therapist coughing cure medication disorder complications spain diurnality undergo human body respiratory dehydration suffering parents adults surgery disorders vomiting washing cardiac infants anesthesia conditions traumatic pregnancy feeling wet sweating outdoors endocrine system sleepover conserved sequence thermoregulation lark siesta nonrapid eye movement nonrapid eye movement sleep nrem sleep orthodox sleep paradoxical sleep rapid eye movement rem sleep period of time time period practice bundling catch a wink sleep in sleep late hole up verb rapid eye movement sleep behavior disorder adenosine triphosphate sensory threshold alcoholism suspensive newborn shut-off stand-down oversleep dogsleep somnifacient neural oscillation metabolism 'd skeletal muscle somatic yawn chronotype abcc9 dec2 cat american academy of sleep medicine pax8 hypotheses vrk2 alarm clock sleep inertia psychoanalysis suprachiasmatic nucleus forebrain optic chiasm bird antidepressant free-running sleep acetaminophen sine wave cortisol awakening response reptile phase response curve electronic media and sleep shift work sleep deprivation songbirds ventrolateral preoptic nucleus tobacco wake ascending reticular activating system frontal cortex cause to sleep go to sleep go to bed imaging studies adult developed country western world somnambulism hypnotic benzodiazepine latin america time zone time in china polyphasic sleep industrial revolution sequence german language antihistamine night owl ambien lunesta ethanol aging dopamine receptor d2 cannabis sleep state misperception major depressive disorder amphetamine teenager sexual intercourse bipolar disorder mdma national sleep foundation cocaine methylphenidate date reactive oxygen species wound healing carbohydrate nonbenzodiazepine work eszopiclone zaleplon para zolpidem anxiety hide lay recovery study down digestion sit food around diphenhydramine time function relaxation live shelter camp cuddle meditation tired stun dreams with chill calm health paralyze energy relax have boot diet naps unconsciousness nomad doxylamine steps lock make find relief low psychosis see power all lounge workout walk and want exercise nightmares but fitness evenings optimization drink nutrition near sharp waves and ripples cramps counter roost members leg strip feed summer tarrytown spore sedative dizzy freeze injury rides protect later too attractive poison became lavender over pitch malfunction impregnated hunger curtains settings ptsd trap yoga lack gives somewhere real sunlight poor anger comfy appetite wakes getting kill change waken attacks melvins danger close cuddling talkative entertain delirious fireball pursue puppet lean button syrup social meditative charm warm has stage silence zone etc racing something deep natural drunk keep will mercury better dissociate killer feel back stupid mattress restless lifestyle kava being break mood house boob space meals roll music watch alarm step talisman leave marry shut terror blanket hybrid family hospital mpr half gets causing comfort cio lab travel attract monitor med dreaming cook repose machine tents activity operation bask hate talk start hydration jerk recover plug videogames plan worst focus passed feeding storm feedings dates potential dance weekends save whatever home flirt report sphere when side intensity circadian ramadan thanatos nyx crete disease fever hygiene sleep spindle theta wave barbiturate dream journal lucid dreams sigmund freud unconscious mind dream interpretation nocturnal penile tumescence allan hobson empathogen-entactogen robert mccarley analeptic modafinil armodafinil micronutrient alcoholic beverage macronutrient psychological stress and sleep nade wakeup hibernated foodor ekg messiness earplugs swaddle respawn bluescreen tmj depressives lofi afk creepypastas stims cataplexy uars burp deepsleep loungewear nosleep numbs hunter-gatherer hypnos filí epimenides white noise obstructive sleep apnea central sleep apnea mortality rate cardiovascular disease periodic limb movement disorder restless leg syndrome upper airway resistance syndrome fatal familial insomnia rebound effect circadian rhythm saturated fat whole grain clinical trial a. roger ekirch segmented sleep immediate family extended family greek mythology john donne samuel taylor coleridge percy bysshe shelley rest in peace imbas forosnai diogenes laërtius mount ida legendary material in christian hagiography seven sleepers persecution of christians in the roman empire washington irving rip van winkle the sketch book of geoffrey crayon, gent. catskill mountains american revolution american literature the sentry carel fabritius the sleep of reason produces monsters francisco goya jérôme-martin langlois honoré daumier sleep and his half-brother death john william waterhouse william-adolphe bouguereau ilya repin albert anker flaming june frederic lord leighton vincent van gogh jean-françois millet paul klimsch wrocław's dwarfs adverse effect medical doctor

Popular Searches

Words Related to sleep

As you've probably noticed, words related to "sleep" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "sleep" are: awake, dream, insomnia, nap, and rest. There are 700 other words that are related to or similar to sleep listed above. Hopefully the generated list of sleep related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like sleep may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is sleep?

Also check out sleep words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of sleep themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr