Stye Related Words

examples: winterunderstandingcloud

Here are some words that are associated with stye: eyelid, hordeolum, eye infection, zit, eyelash, oil gland, staphylococcus aureus, chalazion, antibiotic, sty, human, infection, blepharitis, pus, sweetbread, redingote, oilskin, robusto, sybarite, tippling, knobbed, nosegay, simpering, hassock, elfish, fistula, oompa, fluffer, heartstring, pig. You can get the definitions of these stye related words by clicking on them. Also check out describing words for stye and find more words related to stye using ReverseDictionary.org

Words Related to stye

Below is a list of words related to stye. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to stye:

eyelid hordeolum eye infection zit eyelash oil gland staphylococcus aureus chalazion antibiotic sty human infection blepharitis pus sweetbread redingote oilskin robusto sybarite tippling knobbed nosegay simpering hassock elfish fistula oompa fluffer heartstring pig chimichanga swapper ginormous genoise ectoplasmic grommet band-aid bacterial infection nyam horn-shaped tempur diaster extra-long self-admitted gotong fur-lined eggless diabolo geomembrane codpiece frenulum dagesh coathanger
related words continue after advertisement
djellaba shut-in veloute loompas churrasco diarchy shagreen trollop harai large-volume kusarigama potch pooka sauerbraten cypriote preverb ripieno anong plov gyne spaced-out capelet thingy yyy vulgarian picadillo brochette hotsy norweigan voguish accordian langauge espalier ified writeup at-4 flipbook haematoma seviche larky head-to-toe fluoro slimeball pibil avto propoxyphene gleek mcchicken blubbery beachball shashlik floridly time-delay 65-pound wagamama i-go tournedos noseband foot-long levo kreplach samaraie pimple tinea ophthalmia lumbago scrofula chilblains expectoration fontanelle catarrh soapsuds lockjaw malady slattern glottal paresis cooch rosetta thrush cutty meibomian gland cellulitis gland of zeis warm compresses infant blackhead iritis pinkeye pustule papule keratitis verruca sweatiness unguent chancre phlegmy telangiectasia pinkness tatt scotoma snaggletooth keratosis crabbiness weals mycosis pyogenic haemorrhoid cootie pyoderma hyperkeratosis coryza mottle seborrhea speckling bedhead pathy jeebies unintelligibility dermatosis minge limpness lovesickness gooseflesh vaginitis derma bonce pneumo macules sunray cyanosis eardrops zits moko stridor elavil teddybear pouter mushiness myelopathy labyrinthitis jolliness hypopigmentation scabby achoo bracer epiglottitis lamisil diplopia shmaltz spoonerism cowpat cretinism paratyphoid doorknocker immunoglobulin soap shampoo acetaminophen eye jock itch ingrown hair otitis externa genital wart tinea corporis lichen planus molluscum contagiosum seborrheic keratosis poor nutrition sleep deprivation nutrition erythromycin chloramphenicol hand washing amoxicillin oil glands rosacea histopathology back-formation black box warning aplastic anemia surgical suture

Popular Searches

Words Related to stye

As you've probably noticed, words related to "stye" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "stye" are: eyelid, hordeolum, eye infection, zit, and eyelash. There are 230 other words that are related to or similar to stye listed above. Hopefully the generated list of stye related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like stye may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is stye?

Also check out stye words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of stye themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr