Tea Related Words

examples: winterunderstandingcloud

Here are some words that are associated with tea: camellia sinensis, green tea, black tea, oolong, drink, beverage, tea leaf, coffee, caffeine, herbal tea, afternoon tea, lemonade, pakistan, brew, iced tea, shrub, caffein, darjeeling tea, tang dynasty, drinkable, herb tea, potable, meal, herbal, soda, teatime, chamomile, evergreen, rooibos, beer. You can get the definitions of these tea related words by clicking on them. Also check out describing words for tea and find more words related to tea using ReverseDictionary.org

Words Related to tea

Below is a list of words related to tea. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to tea:

camellia sinensis green tea black tea oolong drink beverage tea leaf coffee caffeine herbal tea afternoon tea lemonade pakistan brew iced tea shrub caffein darjeeling tea tang dynasty drinkable herb tea potable meal herbal soda teatime chamomile evergreen rooibos beer wine camellia coke chicory cuppa camomile burma sichuan chai drinks ba masala chai tipple flower silk road macao mango syrup herbs cider soup chocolate gin teapot cake wassail libation sarsaparilla
related words continue after advertisement
assam song dynasty coffee bean ginger china pu-erh nepal theophylline india tetley turkish tea astringent medicine assam tea lemon fujian xiamen cantonese guangzhou macau cappuccino bush reception herb uk repast britain hybrid yunnan tea brick rosehip shu qin chengdu u.k. cupper redox polyploid posset pepsi shennong imbibe xi'an shijing sowthistle frappe turkey smartweed espresso teas fruit sip chalice oxygen snack coconut sugar juice swig quaff drinker bergamot orange darjeeling vegetable earl grey tea carafe milk lunch snacks cup bottled teacup vegetables beverageware flavored indonesia sipping fruits seafood foods milkshake spiced cola southwest china sweets cane corn breakfast food intemperance rambooze cornwall cooking cereal mocha pannikin bread perthshire collins beverages spices 16th century washington sweet tasting 17th century cakes dishes drinking canned toast beans caffeinated negus hobart baked fresh drinkware salad candy bevvy waikato sipped noodle soft barbecue iced rice toss pomegranate pineapple mixed cereals dairy chicken potation chinese character africa cans eating potato ate plantations flask varieties of chinese taste delicious strain honey peanut bottlo mandarin chinese spicy syllabub buffet mojito wu chinese water ingredients dried fermented shandygaff palm cream min chinese bean pasta dressing carbonated oenomel hemiptera vinegar dessert overdrink eaten hot austro-asiatic languages mosquito yak butter decanter hokkien chinese claree insecticide amoy dialect gulp crapulent kumaun stimulant smoothie horlicks latte pulque dronkelewe bottle fluoride persian language tamarindade aluminium mug fizzy cluster analysis kenya united kingdom of great britain and northern ireland tea bag united kingdom ice tea sun tea great britain genus camellia cambric tea chromosome number bumbo cocoa claret sangaree manganese kefir melonade waucht subtropics rose hip polyphenols swill coffeemaker bavaroise nondrinker shang dynasty bibulous bibacious nightcap beaker tankard caudle emperor jing of han obesity drinkle nondrinking antidrink drinkfest varietal liqueur koumiss bouse smashie antidrinking kava hydromel crapulous predrinks han dynasty wilting oxidation mistelle enzyme chlorophyll chronicles of huayang neknomination helopeltis zhou dynasty serve hot vanilla spearmint winecup gu yanwu theobromine wang bao dextromethorphan emperor xuan of han snifter milkaholic guzzle irish coffee xanthine hua tuo bedrink limeade yuan dynasty ice cream soda ming dynasty something to drink tippler malternative horchata sottish mamajuana container cup cantharus yellow tea flavonoid giambattista ramusio dutch east india company catechins minibar mongolia hirado, nagasaki fizzy drink tibet the hague new amsterdam yak east india company in drink ginger beer chocolate milk peter mundy wish wash morocco samuel pepys algeria use glass feel dizzy catherine of braganza egg cream mauritania charles ii of england soft drink gunpowder tea libya consume beverage tea act soda pop guinea boston tea party black coffee mali american revolution glass of milk senegal toss off opium wars arthur campbell grape juice bamako toddy jasmine sweetmeat scones decoction kir curry cocktail cordials roselle whiskey rhubarb julep rum shandy chablis turmeric teahouse biscuits yoghurt martini tinctures refreshment hot pint you be thirsty beer mug robert fortune hot toddy first opium war second opium war quench your thirst keg stand singpho people fruit punch drink something pick me up tropical climate purple drink taiwan oceanic climate short black mentha tie one on mania potu can of soda vancouver island drink bout electric soup fuddle cup wet one's beak carbonate beverage hardiness zone liquid courage drink driver soil ph ice coffee quench thirst hold coffee john barleycorn japan sri lanka builder's tea milk punch have couple have few brown bottle flu measure liquid dribble glass drink like fish carbonate drink be thirsty café au lait drink drive cup size wine bottle no host bar at bar lapsang tisane pekoe coffe gallate crumpets soursop mauby tealeaves cardamoms decaf tearooms jujubes cardamon hair of dog damsons muscatel marigold sloes elevenses orangeade catechin oatcake creamware coffeepot kokum kesar comfrey ratafia half and half malt liquor full bladder brewer's droop glass onion beer muscle essential nutrient keemun wine glass secondary fermentation gongfu tea ceremony dietary mineral seltzer water daily value open refrigerator epigallocatechin gallate pub crawl may wine peanut milk energy drink samovar hemp milk australia prop up bar alzheimer's disease coca cola drink from hazelnut milk blood cholesterol balochistan enzymatic oxidation alcaligenes l-theanine tannins in tea kashmir theine decaffeinated cardamom chitral argentina marie de rabutin-chantal han chinese manchu people qing dynasty hong kong-style milk tea tibetan people uht milk nestlé buddhism sandwich boiling tetrahedron lipton fairtrade uganda tanzania rwanda steeping malawi zen heat transfer health effects of tea jasmine tea japanese tea ceremony agave nectar kahwah hindu kush western sahara gilgit-baltistan teh tarik orange pekoe camomile tea devonshire cream mulled cider decaffeinated coffee sloe gin digestive biscuit iced coffee castor sugar sparkling wine sour mash apple juice bone china lemon mint cinnamon bark nepal tea nilgiri tea gaiwan desiccant laphet sambucus matcha tea production in sri lanka international organization for standardization iso 3103 moroccan tea culture flowering tea yixing clay tea strainer cold brew coffee tea party tea ceremony chinese tea ceremony yixing clay teapot oolong tea turkish cuisine rize province republic of ireland j. lyons and co. barry's tea russian tea culture michael i of russia arab culture butter tea pashtun people khyber pakhtunkhwa khyber pass noon chai culture of iran planning commission montek singh ahluwalia tarun gogoi sweet tea chinese silk powdered milk huoshan huangya tea freeze drying pu-erh tea tea ball pet film tea chest rationing in the united kingdom during and after world war ii commonwealth of nations world war ii thai salad russian federation pickwick tea pg tips organic certification utz certified rainforest alliance living wage u.s. department of labor child labor southeastern united states tuo cha bai hao yinzhen tea da hong pao tea chun mee tea shelf life instant coffee

Popular Searches

Words Related to tea

As you've probably noticed, words related to "tea" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "tea" are: camellia sinensis, green tea, black tea, oolong, and drink. There are 643 other words that are related to or similar to tea listed above. Hopefully the generated list of tea related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like tea may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is tea?

Also check out tea words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of tea themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr