Tk Related Words

examples: winterunderstandingcloud

Here are some words that are associated with tk: tcl, perl, python, cross-platform, linux, unix, come, ruby, unicode, arrive, free and open-source, forthcome, advent, arrival, widget toolkit, imminent, gui widget, approach, graphical user interface, forthcoming, unix-like, ada, oncoming, oncome, occur, next, haskell, mac os, dux, go. You can get the definitions of these tk related words by clicking on them. Also check out describing words for tk and find more words related to tk using ReverseDictionary.org

Words Related to tk

Below is a list of words related to tk. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to tk:

tcl perl python cross-platform linux unix come ruby unicode arrive free and open-source forthcome advent arrival widget toolkit imminent gui widget approach graphical user interface forthcoming unix-like ada oncoming oncome occur next haskell mac os dux go become reappear band by emerge betide u2 microsoft windows approachable toward be belimp undercome to incoming hectare impend prospective harpsichord armband reach happen appear along cum into accordion concertina bout
related words continue after advertisement
existential immigrate proceed spinet bassoon piccolo clarinet cello succeed befall forthgo eventuate wert future tuba cornet beest xylophone beside abe wast orchestra werewolf mandolin clavichord existent oboe woodwind ensue cymbal piano saxophone clarinetist orchestral lyre banjo flute glockenspiel tambourine bugle consist marimba basic multilingual plane psaltery follow harmonica miscome aftercoming bandless forthgang bandshell forthgoing coexistence wristlet woz weregild motif tkinter hyperinstrument isness begird come on besit truetype font amn't an't befind orchestrion sarrusophone preexistence wasbian neckband beingness come up so's withgo beeth opentype font bassoonist beinghood balalaika wentest bandstring aren't bewill saxhorn betravel keytar saxaphone come in for rexx i'm bandelet unbanded mandola kazoo accordian language binding hsv come off take place next to knowledge come about come in 1a ca cf fc cadherin z bl x cr b myc tnf tl tj tf tc pi at ta rp kb pk ap k ras interferon lac putative on way attach to come back qt wish containment event close to go on music group come out musical group fall through brass band come to go to bass clarinet keyboard instrument march band bass baritone iwsm hsv1 rock band band sectional bass fiddle jazz band retroviral 1 lacz heterologous transfected inducible 2 galactosidase chimeric t wildtype play music music store snare drum perform music make music repetitive strain injury music keyboard woodwind instrument string bass musical instrument brass instrument acoustic guitar come by french horn instrument of music piano accordion string instrument instrument triangle music instrument musical organization play jazz chamber orchestra wind instrument string orchestra acoustic instrument philharmonic orchestra hurdy gurdy music room play tune symphony orchestra music shop play by musician first violin play in band mandolin banjo crash cymbal gtk+ turn out play in orchestra common lisp john ousterhout software versioning de facto standard incr tk

Popular Searches

Words Related to tk

As you've probably noticed, words related to "tk" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "tk" are: tcl, perl, python, cross-platform, and linux. There are 267 other words that are related to or similar to tk listed above. Hopefully the generated list of tk related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like tk may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is tk?

Also check out tk words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of tk themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr