Turtle Related Words

examples: winterunderstandingcloud

Here are some words that are associated with turtle: tortoise, reptile, sea turtle, terrapin, snake, crocodile, amniote, shield, species, plastron, carapace, whale, dolphin, iguana, mammal, shark, order, bone, pleurodira, cryptodira, frog, cartilage, rib, alligator, extinction, leatherback, jellyfish, myr, fish, animal shell. You can get the definitions of these turtle related words by clicking on them. Also check out describing words for turtle and find more words related to turtle using ReverseDictionary.org

Words Related to turtle

Below is a list of words related to turtle. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to turtle:

tortoise reptile sea turtle terrapin snake crocodile amniote shield species plastron carapace whale dolphin iguana mammal shark order bone pleurodira cryptodira frog cartilage rib alligator extinction leatherback jellyfish myr fish animal shell sternotherus proganochelys endangered species painted turtle poikilotherm snail cloaca shell oxygen gill egg convergent evolution lizard green sea turtle ectotherm fossil archelon epidermis protein gorilla keratin cretaceous scute hawksbill
related words continue after advertisement
shellfish caribou geochelone snapping turtle crab giant tortoise loggerhead raccoon leatherback sea turtle crabs owl deer seabird bird humpback hatchlings mesozoic salamander pelican critter penguin heron crustacean creature synapsid sea cucumber diapsid jurassic archosauria amphibian ankylosaur panther porpoise capsize extant taxon turtleneck polo-neck adaptation sea otter monophyletic overturn jersey jumper sweater hunt run cuticle seychelles million crocodilia canada salt jaw testudinidae chelonian slider redbelly t-shirt cooter turtles meiolania fontanelle turn turtle claw flipper rudder australia squirrel gopher tortoise coral nesting cephalopod endangered zooplankton nest insect trionychidae nests worm quail mussel leopard chelydridae abalone mangrove pigeon pheasant sponge testudines dinosaur porcupine habitat algae orchid swamp elephant triassic whales panda darter prairie birds pond grizzly ant tree rattlesnake squirrels oyster zebra mammoth iguanas softshell hunters elk bark pea wild ape cat droppings rainbow zoological scallop clam aquarium bog patch pandas sanctuary wildflower snakes wildlife breeding skins monkeys willow crow pine eagle freshwater larvae crocodiles fauna mammals woodland parrot goose liver form taxon octopus lung permian algonquian languages invertebrate spanish language phylogenetics animalia echinoderm dermochelys coriacea hunt down turtleneck collar soft-shelled turtle tip over pancake turtle painted tortoise painted terrapin chrysemys picta box turtle box tortoise tump over kidney river cooter pseudemys concinna polo-neck collar yellow-bellied terrapin track down pseudemys scripta tee shirt red-bellied turtle red-bellied terrapin pseudemys rubriventris mud turtle marine turtle chelonian reptile turn over pelochelys cantorii gnu alligator snapping turtle mollusc bestial varmint herring centenarian catfish reindeer galápagos islands predator genetic viviparous feral lobster speckled padloper tortoise beastly mud turtles soft-shelled genome yertle rhinoceros south america animalness orangutan animalistic anapsid longevity animality procolophonid clamshell giraffe animalian steinbock millerettid baboon predatory milt goldfish protorothyrididae antizoo zoic seashell vertebrate spine pareiasaur lion gecko beast metazoan untamed blowfish spoutfish emu animalize starfish mollusk coelomate camel platypus chordate zoology aardvark buccal pumping squamata pancake tortoise archosaur hippo cladistics beak eunotosaurus coon bison cetacean moose rabbit prey zoophyte dog paddle teeth ectoderm zoologist anima pig-nosed turtle aquaculture chimpanzee zookeeping monkey armadillo animalism crayfish horn zooblast chorion rod cell meatpacking animal eel smooth pursuit walrus bivalve duck white rat hedgehog zoosmosis marsupial oceanarium skunk capuchin plantigrade encephalization quotient antifur tongue wolverine ostrich hippopotamus omnivore sensuality herbivory chitra antianimal pelusios zoosemantics pelomedusa petkeeper erymnochelys loricate manatee otter seahorse spoonbill dugong gnathostome gannet plover falcon gator flamingo toad cassowary croc auk raptor dragonfly skink willet lobsters shearwater peltocephalus temperature-dependent sex determination palea epizootic marine animal podocnemis negligible senescence zoosemiotics allantois aardwolf pseudemydura aquatic plant exuviae chelodina elusor flaviemys rheodytes sea turtles elseya claudius zoosadism homeotherm emydura myuchelys sheller hibernaculum prototherian buncher hydromedusa zootherapy rhinemys kittiwake vivarium chelus petkeeping mesoclemmys phrynops zoomania body plan gerfalcon manimal platemys odontochelys semitestacea amnion hard shell hispid acanthochelys guangling district placentation live underground carettochelys lissemys zoogenic blastula cyclanorbis evolutionary grade cycloderma sex determination derm trionyx humaneness mammalogy pelochelys rafetus apalone pelodiscus hellbender mudfish clownfish shorebird zygomatic arch era dogania amyda evolutionary biology nilssonia macroclemys at zoo chelydra dermatemys creepy crawly molecular phylogenetics staurotypus water buffalo kinosternon dermochelys natator sea shell chelonia eretmochelys blue whale caretta caribemys oxfordiensis lepidochelys oxfordian stage platysternon red deer actinemys work animal glyptemys china emys pouch mammal emydoidea cold blood animal odontochelys clemmys honey buzzard terrapene deirochelys dorsal fin chrysemys pseudemys wild boar trachemys malaclemys warm blood animal graptemys fin whale manouria aye aye gopherus mexico xinjiang aquatic skull oklahoma land trait louisiana taiwan florida wyoming pet malacochersus non person animal panda bear turtle dove indotestudo killer whale testudo live creature dipsochelys astrochelys pyxis chersina homopus psammobates toothed whale some animal chelonoidis kinixys bee eater sea cow rhinoclemmys water bear cell wall breathe air geoemyda cabbage moth siebenrockiella artillery shell biological class panayanemys great white shark malayemys orlitia geoclemys morenia kachuga loggerhead turtle hawksbill turtle diamondback terrapin whale shark leatherback turtle sea lion humpback whale hammerhead shark smalltooth sawfish moray eel garter snake aquatic mammal komodo dragon proboscis monkey wolf spider harbor porpoise bottlenose dolphin harlequin duck flightless bird steller sea lion olive ridley rat snake bald eagle horseshoe crab wolf pup harp seal wood stork river otter caretta caretta hermit crab sting ray slow loris cattle egret ocean sunfish pygmy sperm whale indigo snake pangshura hardella batagur callagur vijayachelys cistoclemmys cuora heosemys sauropsid salmonellosis guilinggao chinemys cyclemys notochelys sacalia mauremys carbonemys melanochelys leucocephalon upper triassic extinction event upper jurassic adaptive radiation tampa international airport sequence analysis scientific literature north carolina state university nemegt formation north dakota shanshan county world turtle day hong kong people's republic of china invasive species florida fish and wildlife conservation commission softshell turtle fort lauderdale russian tortoise spur-thighed tortoise red-eared slider kemp's ridley united states traditional chinese medicine the caribbean turtle farming grand cayman turtle soup u.s. food and drug administration

Popular Searches

Words Related to turtle

As you've probably noticed, words related to "turtle" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "turtle" are: tortoise, reptile, sea turtle, terrapin, and snake. There are 638 other words that are related to or similar to turtle listed above. Hopefully the generated list of turtle related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like turtle may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is turtle?

Also check out turtle words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of turtle themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr