Wifi Related Words

examples: winterunderstandingcloud

Here are some words that are associated with wifi: wireless, ethernet, ieee 802.11, local area network, bluetooth, wlan, router, wi-fi protected access, wireless lan, wireless access point, encryption, ios, wi-fi alliance, wi-fi protected setup, institute of electrical and electronics engineers, wired equivalent privacy, ism band, pun, 3g, internet, hotspot, interoperability, wi-fi, connectivity, broadband, dsl, station, bandwidth, adapter, transport layer security. You can get the definitions of these wifi related words by clicking on them. Also check out describing words for wifi and find more words related to wifi using ReverseDictionary.org

Words Related to wifi

Below is a list of words related to wifi. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to wifi:

wireless ethernet ieee 802.11 local area network bluetooth wlan router wi-fi protected access wireless lan wireless access point encryption ios wi-fi alliance wi-fi protected setup institute of electrical and electronics engineers wired equivalent privacy ism band pun 3g internet hotspot interoperability wi-fi connectivity broadband dsl station bandwidth adapter transport layer security isp phones modem iptv tethering blackberry iphone firewall wi-fi direct personal area network wide area network wireless network interface controller
related words continue after advertisement
motorola cable modem uhf smartphone lan microwave oven australia 2g 4g alohanet lte routers wavelan wireless fidelity wireless local area network interbrand zigbee messaging videoconferencing adapters wimax conferencing wi isdn gprs non-profit adsl voip telephony cdma cellphones wirelessly msn unencrypted transmitting super high frequency gps pcs personalization networking interactivity gsm fi paging servers emulation fon smartphones webcams dial zune handsets vpn emulators business browsing wideband firewalls pagers laptops desktops headsets networked modems multicast usb kiosks tablet computer webcam transmitters terminals dvr desktop irc cellular networks accesses users interfaces tcp nexus hd antennas workstations android bada symbian hi-fi narrowband backhaul ncr corporation mysore at&t corporation 802.11 teleconferencing john o'sullivan organisation minneapolis on-demand organization commonwealth scientific and industrial research organisation london ieee 802.11b-1999 dial-up organize standard organizational organise built-in linksys hookups point-to-point hookup hogging pittsburgh interpol ftth northpoint high fidelity uunet step-free advertising slogan internetworking webtv psinet tracfone yin and yang jmurray federation motorola canopy fixed wireless newsgroup nasa disorganization bureaucracy hertz mifi someplace wibro backward compatibility ballgame somewhere reorganize interference service set establishment privatization recruitment metrofi anybody transmitter hierarchy studio nowhere insider eir preorganization institution unionisation radio station territorialization fiefdom extensible authentication protocol reorganization quango administration super wi-fi airmail federal communications commission eduroam broadcast systematization media access control physical layer somebody subsidiary ieee 802.11y-2008 chipset skype cingular fone samsung dvi powerbook ssh syncing gmail laptop util ibiza lcd hdtv baud starbucks htc wap moby colo scart pda linux hulu gamecube ovi rogers lenovo sbc addy txt reva georgetown sony nokia scsi conn acer slashdot kingston mcafee scp heathrow msi toshiba radiohead connexion firmware moscow loo austria nav manhattan simms optimus ombudsman corporate ieee 802.11ad smithsonian cooperative broadcaster newscast methodical databank courier syndication conservancy consortium infrastructure metropolitan area network company institutional mastermind freemasonry anywhere ieee 802 treasurer tdls inductee organigram organizer ventilation data sweatshop corporation laundromat overseas indoors best-effort delivery system benelux airbus ethernet frame association collectivize blimp restructure internet access multinational campground airframe everywhere anyone picnic wireless network google aria depot u-nii wireless mesh network routing captive portal digital subscriber line international space station carwash television station airport unionize treo dongle tomtom vonage earthlink mapquest acces froyo ymmv megs skyping precentral trackpad cheeper bbm multiuser lightrail miq wpan prox autocorrect kilobit bridging baloon adhocracy postdisco museology windows phone oem someone's stoplight sysop voicebank waveguide postlude expresscard st. cloud, florida world health organization sunnyvale, california airwave reair cyberbank minneapolis wireless internet network boris johnson self organization carnegie mellon university wireless andrew g.hn international olympic committee wireless ad hoc network fannie mae unite nation multiplayer video game handheld game console nintendo ds world bank playstation portable digital camera phone bank consumer electronics barcode enterprise architecture wit end roaming data warehouse teach open mind university campus part 15 in africa sharpen knife climb ladder florida website graffiti dbm catch on fire cordless telephone orange order knight templar world organization toll booth press relation astral plane power station lose and find net raise signal-to-noise ratio play golf hold company change management play ping pong credit union secret society itu-t human resource mow lawn business intelligence swim in ocean trade union something else video sender girl scout paddle canoe play volleyball baby monitor station break terrorist organization amateur radio labor union side of road white house no one open pit mine walk to school ride train mental hospital compose music private sector file system communication system ethernet cable baud rate mesh topology swim in lake backwards compatible blow up balloon another place help desk rob bank play computer game document folder answer phone mobile phone system engineer information technology access point audit trail little league railway station market product football stadium go to town ethernet hub television network wal mart bottom of lake nation of islam cross bridge air duct write computer program pick flower out of door space station hold rein ivy league universal serial bus on air privacy policy in mail box financial institution affinity card unlock door board of director aircrack-ng dect passphrase wardriving wpa2 warchalking airsnort radio propagation middle of road pc card legal entity livery company police force wireless router solitary confinement nerve center political system theme park network switch meet and greet internet protocol network address translation domain name system dsl modem web server airport utility mac os x consumer entertainment device isotropic radiator directional antenna title 47 cfr part 15 equivalent isotropically radiated power radio frequency category 6 cable local area networks ethernet over coax power line communication signal reflection long-range wi-fi pico el águila swedish national space board cellular network network intelligence mesh networking virtual private network onetime pad http secure dynamic host configuration protocol zero configuration networking man-in-the-middle attack hypertext transfer protocol temporal key integrity protocol international agency for research on cancer health protection agency electromagnetic hypersensitivity graphical user interface fluhrer, mantin and shamir attack advanced encryption standard mac spoofing internet service provider case law mac address wireless community network

Popular Searches

Words Related to wifi

As you've probably noticed, words related to "wifi" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "wifi" are: wireless, ethernet, ieee 802.11, local area network, and bluetooth. There are 559 other words that are related to or similar to wifi listed above. Hopefully the generated list of wifi related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like wifi may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is wifi?

Also check out wifi words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of wifi themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr