Yds Related Words

examples: winterunderstandingcloud

Here are some words that are associated with yds: yard, backyard, foreyard, dooryard, patio, garden, horticultural, furlong, horticulturist, three foot, courtyard, rosebush, lawn, horticulture, yardarm, stockyard, landscape, gardener, tract, schoolyard, neighborhood, lea, field, suburb, park, outdoor, shovel, back yard, fielden, yardgrass. You can get the definitions of these yds related words by clicking on them. Also check out describing words for yds and find more words related to yds using ReverseDictionary.org

Words Related to yds

Below is a list of words related to yds. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to yds:

yard backyard foreyard dooryard patio garden horticultural furlong horticulturist three foot courtyard rosebush lawn horticulture yardarm stockyard landscape gardener tract schoolyard neighborhood lea field suburb park outdoor shovel back yard fielden yardgrass parrock sward farmhouse grassy hometown grass front yard yardstick centimetre ficus condominium acre tds yards ints touchdowns yardage avg rushers pts att mcnabb tailback yarder receptions downfield soph bucknell
related words continue after advertisement
punt passer rebs peyton heisman sacks catches rbi rushes niners backfield defensed rodgers lsu gibbs metres wesleyan briggs bengals kickoffs tackler interception depauw jerome tebow chavis jennings herm pund fum quarterback kimbrough skelly obp iain kyle hess fletcher fsu gerrard unlv precinct habitation residential homestead spray hose brownstone gardenhood edinburgh meadow townhouse house hacienda villa terrace inch suburban footrope front garden hose wildflower countryside grove shrubbery home dockyard vineyard metre footer houseless infield cottage back garden coalfield outdoors ranchhouse residence outdoor location outfield lawngrass dwell fielder habitat planta mansion halyard duplex lateen hermitage topiary cubic yard atts nyg hgt qbs scatback akr asts yardline wideout outrush efg strs fusee placekick cln blitzer grn rockling hashmark mtr hwt grow flower rose garden grassplot hizzle garden hose ballyard woodyard footbreadth ryegrass woold housepride lemongrass shortgrass arshine small dog megafoot displant kilofoot remiped stairfoot bandle fieldman stableyard cubic metre houseling wirehouse dosshouse gardenwork housebuyer clawfoot beanfield rehouse clawfooted cohoused catalexis cubic centimetre wike bunchgrass hyem footpeg statute mile play in play field flower garden market garden wild flower vegetable garden wiener dog live in order field interior area square yard botanical garden unit of measurement front courtyard plant seed flower bed terrace house measure distance grow vegetable scalar field soccer field baseball diamond apple tree where person live shot put running back high jump third period own goal tom brady john tyler running game long jump signal caller point out second period running time first period keep an eye on rapid transit football player first quarter gustavus adolphus field goal north northwest grow garden commutative ring kitchen garden country house linear unit beetle bank your yard row house apartment house acre foot sunday house plant flower board foot front of house mini bar integral domain mount everest city park noetherian domain wall garden live place cubic foot house music rural area unique factorization domain every house modern residence principal ideal domain tank farm some food nautical mile in countryside dwell place where live gunter's chain grow food sump pit mobile home grill steak find in garden center field holiday home second home

Popular Searches

Words Related to yds

As you've probably noticed, words related to "yds" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "yds" are: yard, backyard, foreyard, dooryard, and patio. There are 294 other words that are related to or similar to yds listed above. Hopefully the generated list of yds related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like yds may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is yds?

Also check out yds words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of yds themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr