Yl Related Words

examples: winterunderstandingcloud

Here are some words that are associated with yl: methyl, hydrocarbon, polymer, isomer, organic compound, double bond, amino acid, triple bond, hydrogen, halogen, carbon, organic chemistry, parent compound, radical, biochemistry, atom, isomeric, dioxin, amine, aldehyde, alkene, aliphatic, azo, thiol, dioxide, diene, moiety, carbonaceous, styrene, nitro. You can get the definitions of these yl related words by clicking on them. Also check out describing words for yl and find more words related to yl using ReverseDictionary.org

Words Related to yl

Below is a list of words related to yl. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to yl:

methyl hydrocarbon polymer isomer organic compound double bond amino acid triple bond hydrogen halogen carbon organic chemistry parent compound radical biochemistry atom isomeric dioxin amine aldehyde alkene aliphatic azo thiol dioxide diene moiety carbonaceous styrene nitro nitrogenous unsaturated ane molecule bromine superoxide radiocarbon hydride ketone monoxide aza peroxide trioxide tetrachloride diazo pyridine hfc heterocyclic ethylene alkyl chlorofluorocarbon fluorocarbon
related words continue after advertisement
amino oxide monomer ammonia graphene phenol benzene iodide ph organic carboxyl carbonyl arsenide carburet furan oxime organo halogenated monoterpene alkalamide amide peptide polymers nitride hydrazine acetylene halomethane pyrrole nitrile inorganic toluene indole polycyclic dimer nitrate naphthalene carboxide hexafluoride acyclic fluoride alkylidene cyanohydrin protein halogenation terpene cyanocarbon triazine monacid univalent heterocycle allene heteroallene cyclohexene triterpene tetrathiafulvalene amidogen trichloride dinitrogen vinylene sesterterpene hcfc alkane heterocumulene hemiterpene ethene polyether linoleic sulfone halohydrin deutoxide phosphazene diterpene hexacid sulfurette siloxane hydracid pentoxide tetroxide pentacid thiazole episelenide episulphide nitrol ethyne dichloride fullerene petrochemistry pentachloride diazomethane sesquiterpene carbochemistry l j isopropyl io hexyl h g formyl f ethyl d cyclohexyl choline phenyl butyl bis ym ene benzylic b amyl allylic acetate oo a 3h octyl heptoxide phosphoric nicotinic methylene phosphate aryl naphthyl hydroxy tf mc ld propyl propene oxamidine pyran carbocyclic oxyacid bisphenol disodium trifluoride monochloride acrylonitrile monopotassium hydroxybenzoquinone oxetane nitrogenize thiophene tetrazone hydroxyanthraquinone monocalcium tetrafluoride sesquioxide spectrochemistry tetrahydroxyanthraquinone difluoride alicyclic phosphinine tetraterpene pentafluoride oligomer dihydroxyanthraquinone arsinine heteroradical quantivalence parent chain methyl group chemical compound carbonyl sulfide sulphamic acid side chain carboxylic acid inorganic compound acyl halide ethylene oxide pendant group carbon disulfide general formula hydrogen chloride inorganic polymer dicarboxylic acid benzene ring hydrogen cyanide sulfur hexafluoride inorganic chemistry glyceric acid phthalic acid calcium carbide functional group fatty acid carbon 14 straight chain cyanic acid carbon 13 chemical element gluconic acid binary compound lysergic acid affix alpha carbon iupac vinyl polyvinyl single bond polar effect inductive effect mesomeric effect rest steric effects halides greek language hydroxyl chlorine methoxy phosphorus nitrogen oxygen sulfur selenium cheminformatics carbamate structural formula ethyl group charles frédéric gerhardt

Popular Searches

Words Related to yl

As you've probably noticed, words related to "yl" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "yl" are: methyl, hydrocarbon, polymer, isomer, and organic compound. There are 268 other words that are related to or similar to yl listed above. Hopefully the generated list of yl related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like yl may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is yl?

Also check out yl words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of yl themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr