Zu Related Words

examples: winterunderstandingcloud

Here are some words that are associated with zu: zubird, ae, a, und, zeta, me, myself, sumer, i, them, itself, thon, yours, my, him, their, hers, mab, thou, the, fürst, his, you, an, who, rantzau, that, ye, those, pronoun. You can get the definitions of these zu related words by clicking on them. Also check out describing words for zu and find more words related to zu using ReverseDictionary.org

Words Related to zu

Below is a list of words related to zu. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to zu:

zubird ae a und zeta me myself sumer i them itself thon yours my him their hers mab thou the fürst his you an who rantzau that ye those pronoun guttenberg of freiherr her which n u engels z himself per he o führer grün xor ette bei kwak bahay vom in einer maki not nog eugen we herr s uns cumann thereof eine self theodor einem one's nicht nadezhda fürstenberg neither viet meck iv what minin sachsen von k pfeil
related words continue after advertisement
oneself danae b cong studien phan danske haben wir silber either schön any choy therein goebbels wirtschaft mises niet moltke shihab horst therefrom anh wissenschaften tu dai götz prinzessin heer it kani der tre auch isang nien sheela ded jun ein zwei teil j volk jaar katte bonde hardenberg bok friedrich nand hereto thereon thereto v hereof therewith at w for nor from yourself semitic deity l f chongzhi since herewith whereon whereof therefore hereby or yo hereupon whereto xi she whereas abe hereunto wherefrom whereby thereupon each whereupon um etz whereat whereafter than sayn-wittgenstein into i'm humboldt-universität therewithal amateur thereafter alone wherewith with wherefore non they ne besides on alphabetic unspecified and phung abc herein hereafter reichskanzler ego blau au as solz r else d'anjou wherever also hither eulenburg within although ab it's d'arco ayudhaya karl-theodor königin fuehrer tebe p d everywhere déjeuner beth e upon alphabet to mío herself whatever during i've wissenschaftskolleg amte ah prittwitz karm micale h none erjavec diye wherein thus mu g nowhere us anything however thereagainst alphabetical anyone there palochka anybody anywhere somebody here thereat aleph one q every im ampere whereinto dystias whereunder m so's aren't t thereinafter personal pronoun hereon s he roman alphabet blood type my ass blood group reflexive pronoun monoclonal antibody this one spectral class that one out of hebrew alphabet fia ba declination ef eh dependence fig fio lo cf sentiment aus spin accords adverb fashion ag scarlet letter alpha privative in mail latin alphabet no one in mail box slovene alphabet there be zu/is zunyite 10 50 400 3.5 200 20 140 100 1.6 80 150

Popular Searches

Words Related to zu

As you've probably noticed, words related to "zu" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "zu" are: zubird, ae, a, und, and zeta. There are 323 other words that are related to or similar to zu listed above. Hopefully the generated list of zu related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like zu may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is zu?

Also check out zu words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of zu themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr