Amnesia Related Words

examples: winterunderstandingcloud

Here are some words that are associated with amnesia: forgetfulness, retrograde amnesia, anterograde amnesia, memory, brain damage, blackout, memory loss, drug, sedative, selective amnesia, hallucination, psychosis, convulsions, neurosis, paralysis, phobia, shyness, affliction, deafness, derangement, blindness, hangover, senility, hypnotic, disease, irregularity, burnout, delirium, hallucinations, traumatic. You can get the definitions of these amnesia related words by clicking on them. Also check out describing words for amnesia and find more words related to amnesia using ReverseDictionary.org

Words Related to amnesia

Below is a list of words related to amnesia. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to amnesia:

forgetfulness retrograde amnesia anterograde amnesia memory brain damage blackout memory loss drug sedative selective amnesia hallucination psychosis convulsions neurosis paralysis phobia shyness affliction deafness derangement blindness hangover senility hypnotic disease irregularity burnout delirium hallucinations traumatic pathological congenital infantile greek language momentary insufficiency melancholia dissociative hemorrhage catharsis disfigurement overload incurable
related words continue after advertisement
delusions transference undiagnosed disorder hiccup insomnia obsessive incapacitation deformity claustrophobia relapse sciatica migraines indignity insomniac complication febrile awkwardness cerebral familial feigning loneliness reminiscence disconnection pangs convulsion remission immeasurable torment indisposition célèbre unexplained suffers symptom neurological inexplicable gratification dementia irreparable debilitating abnormality haemorrhage arrhythmia immaturity transgression untimely introspection depressive traumas narcissism adrenal brain hippocampus cognitive state transient global amnesia posttraumatic amnesia state of mind anterograde psychological trauma iatrogenic homesickness uremia manic-depressive acromegaly psychogenic drug-induced hemorrhaging dysregulation misattribution agoraphobia berenices stagefright aids-related misdiagnosis aftereffects powerd priming diencephalon fmri hypochondria delusion flashbacks disorientation malady paranoia vertigo coma stupor dumbness tourette somnambulism porphyria consciousness alexia myopia lycanthropy unconsciousness monomania itis lethargy nightmares lockjaw revisionism weirdness psychosomatic giddiness concussion confabulation insanity dizziness numbness trope aliment hysteria stupidity trama apathy short-term memory long-term memory fogginess boneheadedness kleptomania discombobulation suspiciousness neurosyphilis catatonia incoherency infantilism wooziness acrophobia epiphenomena anosognosia speciousness bipolarity prosopagnosia conniption bewitchment daze shadiness hyperreality hypomania logorrhea yips cataclysms deficiency of rbap48 protein and memory loss alcohol psychology non-declarative memory thiamin senile dementia psychogenic fugue nervous breakdown cognitive dissonance depersonalization disorder grand mal catatonic schizophrenia survivor guilt temporal lobe epilepsy dissociative disorder delirium tremens petit mal inferiority complex auditory hallucination manic depression cabin fever paranoid schizophrenia epileptic seizure basal ganglia premotor cortex korsakoff’s syndrome pill reminder wernicke–korsakoff syndrome theodule-armand ribot implicit memory brenda milner william beecher scoville ribot's law henry molaison

Popular Searches

Words Related to amnesia

As you've probably noticed, words related to "amnesia" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "amnesia" are: forgetfulness, retrograde amnesia, anterograde amnesia, memory, and brain damage. There are 216 other words that are related to or similar to amnesia listed above. Hopefully the generated list of amnesia related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like amnesia may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is amnesia?

Also check out amnesia words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of amnesia themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr