Anabolism Related Words

examples: winterunderstandingcloud

Here are some words that are associated with anabolism: catabolism, constructive metabolism, metabolism, cellular respiration, molecule, set, assimilation, absorption, energy, metabolic, cell, pyruvate, nadph, purine, glycolysis, efflux, triphosphate, monoamine, diphosphate, glutamine, hmg, leucine, superoxide, pyrimidine, guanosine, uracil, vasodilation, leucocytes, erythrocytes, tyrosine. You can get the definitions of these anabolism related words by clicking on them. Also check out describing words for anabolism and find more words related to anabolism using ReverseDictionary.org

Words Related to anabolism

Below is a list of words related to anabolism. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to anabolism:

catabolism constructive metabolism metabolism cellular respiration molecule set assimilation absorption energy metabolic cell pyruvate nadph purine glycolysis efflux triphosphate monoamine diphosphate glutamine hmg leucine superoxide pyrimidine guanosine uracil vasodilation leucocytes erythrocytes tyrosine nadh lipids endocytosis transduction nicotinamide efferent trypsin kaarina greek language thyrotropin peroxidation gluconeogenesis phosphocreatine catecholamine elastase sphingomyelin
related words continue after advertisement
fucose osteoblast thermogenesis micronuclei eicosanoid proteolysis eicosanoids lipolysis vasodilatation xanthine estrone nephron proteoglycan melanocyte secretase enos peroxisome dephosphorylation polyamine cobalamin erythropoiesis monocyte potentiation mitogen bradykinin plasminogen vasoconstrictor contractility atherogenesis catalase mineralocorticoid plasmin autoregulation ascorbate isoprenoid palmitate epithelia glucosides baroreceptor mucins phagocyte proinflammatory oestrogen detrusor hepatoma hydroxyproline asparagine oxidants haem cholecystokinin sectionalism dijana karylle unenlightening metabolic pathway refolding behaviourism anti-capitalism liku steinhausen tounkara zorana anzhelika chergui mbogo germnay ilze burewala zakharchenko naoe wielopole ussel turri poststructuralism crownover kabaha recyclability banovići bohlmann planinc flávia locksmithing veerle postcolonialism arabinose dragiša stanislavs makwana continuous-flow galica sangaré cherveniashka drug-taking annaliese egocentricity arnfinn burcu calcium-dependent dalwhinnie samsat oskari dejene tanju kuroiwa jaanus kuźnia maulik stagniunas christan władysławowo sungrebe kolad shaina madhom busso natel wude heteronormativity dishevelment nedeljkovic afanasiev zipaquirá joura 30g suguru schüller pontremoli anti-nationalist ukrain selb hasel skarbimierz unstrained dimethylamine wair sadha black/white olia figure-ground post-colonialism sinikka lahor free-wheeling facc 5-92 self-promoting atanassov grgic ghanbari metabolic process organ tissue oxidative phosphorylation osmotic pressure gamma aminobutyric acid superoxide anion adrenal cortex leydig cell beta endorphin inorganic phosphate neuromuscular junction creatine phosphate calcium ion parathyroid gland anterior pituitary adenosine triphosphate bone atp hydrolysis muscle unit hormone insulin chemical synthesis endocrinologist anabolic steroid circadian rhythm

Popular Searches

Words Related to anabolism

As you've probably noticed, words related to "anabolism" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "anabolism" are: catabolism, constructive metabolism, metabolism, cellular respiration, and molecule. There are 217 other words that are related to or similar to anabolism listed above. Hopefully the generated list of anabolism related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like anabolism may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is anabolism?

Also check out anabolism words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of anabolism themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr