Atticism Related Words

examples: winterunderstandingcloud

Here are some words that are associated with atticism: attica, athens, greece, rhetoric, classical greek, sophist, peroration, mediterranean, lucian, ancient greek language, hellenistic greece, byzantine, hellenistic period, renaissance, idiom, attic orators, alexandria, atticize, grecism, italicism, grecize, italianism, dorism, euphuist, doricism, sinicism, hispanism, vernacularism, brachyology, laconism. You can get the definitions of these atticism related words by clicking on them. Also check out describing words for atticism and find more words related to atticism using ReverseDictionary.org

Words Related to atticism

Below is a list of words related to atticism. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to atticism:

attica athens greece rhetoric classical greek sophist peroration mediterranean lucian ancient greek language hellenistic greece byzantine hellenistic period renaissance idiom attic orators alexandria atticize grecism italicism grecize italianism dorism euphuist doricism sinicism hispanism vernacularism brachyology laconism idioglossia extradictionary syllabism antefix phonotypy desiderative cockneyism chaldaism hellenistically englishism ciceronianism glossic paronym normanism calligram faliscan
related words continue after advertisement
johnsonese gongorism laconize comitative greekling saxonism hypallage briticism romaic tralation latinism glossology glyconian euphuize tagmeme tushery echoism epanadiplosis brachylogy latinly pauciloquy germanist frenchism panhellenium pasigraphy anacoluthia amphimacer kyriology hibernianism iotacism strabo renaissance era plutarch greek people josephus dionysius of halicarnassus expressive style subject case vulgar latin figure of speech set phrase artificial language basic english late latin hellenic language alpha privative modern greek classical latin optative mood acute accent heroic verse dead language low latin biblical latin linear b vers de societe vocative case dog latin new criticism latino sine flexione early modern english rhetorical device grave accent italic language formal language give voice verb phrase noun phrase common noun old french medieval latin content word medieval greek middle dutch concrete noun aelius herodianus phrynichus arabius eustache le sueur jacques stella public domain template:cite catholic encyclopedia catholic encyclopedia

Popular Searches

Words Related to atticism

As you've probably noticed, words related to "atticism" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "atticism" are: attica, athens, greece, rhetoric, and classical greek. There are 123 other words that are related to or similar to atticism listed above. Hopefully the generated list of atticism related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like atticism may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is atticism?

Also check out atticism words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of atticism themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr