Bulldozer Related Words

examples: winterunderstandingcloud

Here are some words that are associated with bulldozer: tractor, loader, truck, dozer, mining, quarry, excavator, backhoe, angledozer, shovel, construction, humvee, barricade, sand, jeep, forklift, driveway, tank, plow, demolition, helicopter, earthmoving, soil, farm, mud, forestry, blade, caterpillar inc., debris, bulldozers. You can get the definitions of these bulldozer related words by clicking on them. Also check out describing words for bulldozer and find more words related to bulldozer using ReverseDictionary.org

Words Related to bulldozer

Below is a list of words related to bulldozer. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to bulldozer:

tractor loader truck dozer mining quarry excavator backhoe angledozer shovel construction humvee barricade sand jeep forklift driveway tank plow demolition helicopter earthmoving soil farm mud forestry blade caterpillar inc. debris bulldozers snow komatsu limited roadblock steamroller cruiser tungsten continuous track bunker earthmover jeeps rammed armored steel ambushed blew ferry alloy barricades shotgun roller propelled grenade strafed sped parked digging
related words continue after advertisement
heavy industry bulldozed trenches encircled assailants armoured detonated excavators booby tanks california ramming dug checkpoint ablaze dynamited bunkers lathe mows mortars cat tractors deuce assailant launcher barricaded lava hydrant fence mortar demolishing snipers bullet encirclement rusted rolled motorbike storming wheeled scorched bazooka grenades ground pressure cup extinguisher machinegun kalashnikov repulsed guardhouse scaffolding cong boomer gunman embankment emplacements chased machine sawmill submachine emplacement ambush firing digger crane trencher rubble lorry excavation wrecker wheelbarrow chainsaw scraper pickaxe machinery gravel mower dredger lawnmower wreckage boulders sappers watchtower grapnel minibus van mattock ambulances workmen cart convoy barge locomotive deforestation tractive force d9 road building armor machine-gun podzol backhoes counter-attack ak-47 land clearing sandbagged greenside rc-12 d.v 18-wheeler d.iii guardrail kosmos-2i checkpost well-oiled rockot 18-wheel firebomb three-bladed skidder snowplow jackhammer snowplough rototiller swather bulldozing dragline pickax compacter landrover firetruck swamper snowshed posthole dustcart tractoration airboat tailboard wheel tractor-scraper fresno scraper james porteous cut and fill combat engineering vehicle artillery tractor canal hitachi type 73 dam m8 tractor rake main battle tank earthworks cement mixer concrete mixer cherry picker tow truck tractor trailer dump truck power shovel armored vehicle road roller snow plow donkey cart pickup truck gun emplacement tipper lorry tipper truck gravel pit caterpillar track tree stump street sweeper articulated lorry cypress tree riding mower lawn mower combat engineer case ce israeli defence forces idf caterpillar d9 second intifada liebherr copper piledriver hammer strike action hydraulics gps military landmines eminent domain terex marvin heemeyer fiat-allis holt manufacturing company beml world war i morrowville, kansas caterpillar 60 topcon shantui homophone euclid trucks allis chalmers liugong construction machinery, llc. deere & company international harvester r.g. letourneau automatic transmission winter of 1946–47 in the united kingdom trimble inc leica geosystems liebherr group john deere caterpillar d9

Popular Searches

Words Related to bulldozer

As you've probably noticed, words related to "bulldozer" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "bulldozer" are: tractor, loader, truck, dozer, and mining. There are 262 other words that are related to or similar to bulldozer listed above. Hopefully the generated list of bulldozer related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like bulldozer may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is bulldozer?

Also check out bulldozer words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of bulldozer themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr