Conjugate Related Words

examples: winterunderstandingcloud

Here are some words that are associated with conjugate: chemistry, bound, chemical science, compound, conjugation, coupled, combine, merge, coalesce, blend, conflate, conjugate solution, united, valence, dimer, permutation, bivalent, dimers, oligomer, peptide, thiol, quinone, quinoline, conjugated, change, meld, biology, mix, flux, fuse. You can get the definitions of these conjugate related words by clicking on them. Also check out describing words for conjugate and find more words related to conjugate using ReverseDictionary.org

Words Related to conjugate

Below is a list of words related to conjugate. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to conjugate:

chemistry bound chemical science compound conjugation coupled combine merge coalesce blend conflate conjugate solution united valence dimer permutation bivalent dimers oligomer peptide thiol quinone quinoline conjugated change meld biology mix flux fuse solution inflect commingle immix recombination transpose unite isomorphic cyclic vectors hermitian diene momenta combination valent amalgamation conjugates merger invertible scalars coefficients diazo covariant
related words continue after advertisement
amalgamate vector endpoints matrices carbonyl nitride protonated anhydride orthogonal unify methylene integrate monomer symmetric enantiomers amplitudes adenosine scalar quaternion bilinear synthesis apical discriminant inverse angular linear unification pka hydrous synthesize isomer fusion numerically parameter immunoglobulin synthetic approximated conjoint organometallic peptides vertex subset hyperbola equivalently indole projective tangential classifier genotype acyclic eigenvalues biochemistry foci unsaturated coalescence approximations arsenide isometric quaternions pyridine biochemist finite parametric hydrophobic amino enantiomorph tritone helvellyn probabilities organic denoted rapport polyunsaturated spectral derivative polymer tetrachloride poly pinnate conjunction styrene consolidation nitrile nitro hydroxide recombine amalgam iodide spectrochemistry saturate inorganic ph solvate catalyze aldehyde acceptor electrochemistry biological science alchemy iodinate isogonal chemically mixture noncompound decompound ketone polymerize exotherm combinate monovalent combinative sulfurette syncretize compoundable pgl polyvalent combinatorial codice_5 flavone immunochemistry trivalent delocalization combinable clathrate spacelike allomerism binate wavenumber codice_6 combinatory macrochemistry oleochemistry codice_2 codice_4 univalent carburet non-zero thermochemistry glycochemistry neurochemistry delocalize femtochemistry tetrazone codice_3 polysynthesis triazine conjoin isomerization cyanohydrin formula_6 metallocene formula_18 piezochemistry admix formula_9 preconditioned petrochemistry formula_4 integrand formula_19 nonlinearity photochemistry carbochemistry nitrogenize codice_1 traceless formula_3 formula_5 formula_2 siloxane formula_12 formula_1 formula_20 bisphenol codice_7 formula_8 magnetochemistry formula_10 formula_11 oxime autotomy pseudovector quantivalence formula_13 formula_30 radiochemistry cyclophane pyrrole amphoteric halogenation halogenated lewis base interchain electrophile cryosequester chemic cyano interblend federate tetrathiafulvalene alkalize sulfone alkalamide dihydropyran miscible allomorph zoochemistry heterocumulene zoöchemistry iatrochemistry actinochemistry interjoin dyad heteroallene monoterpene lewis acid phospholipid covalent pyrimidine divalent mannose disulfide ribosomal adduct peroxidase ligand amide cooh uracil ligase polypeptide triphosphate pyrophosphate nucleoside flavin tubulin rnase transmembrane molecule bilayer racemic carboxylate synthetase moieties stereochemistry cytosine rostral guanosine acyl homology serine mab keto atpase reaction mixture chemical fingerprint isotopic chemistry inorganic chemistry hyphenate compound equivalent weight combinatorial chemistry yoke together acyl halide organic chemistry carbon disulfide combine weight chemical decomposition dicarboxylic acid long chain open compound side chain organic compound single bond tetramer hapten avidin ribonuclease hepatoma porphyrin cytochrome macrocyclic sphingomyelin dnase amphiphilic alkane valine gyrase agonism osteoclast vinblastine stilbene chromophore epitope imidazole glycopeptide macromolecule endonuclease alkynes mononuclear phosphoprotein replicon cytidine dipeptide fibronectin imine tripeptide esterase thiols cyto peptidoglycan ganglioside nucleoprotein tropomyosin dextran microcapsule micelle nucleocapsid cross link enkephalin cytotoxin compound word hydrogen cyanide amino acid general formula sulphamic acid gluconic acid transannular strain binary compound chemical compound functional group band together phthalic acid lone pair glyceric acid dissociation reaction carboxylic acid neuromuscular junction xenopus laevis

Popular Searches

Words Related to conjugate

As you've probably noticed, words related to "conjugate" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "conjugate" are: chemistry, bound, chemical science, compound, and conjugation. There are 386 other words that are related to or similar to conjugate listed above. Hopefully the generated list of conjugate related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like conjugate may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is conjugate?

Also check out conjugate words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of conjugate themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr