Digital library Related Words

examples: winterunderstandingcloud

Here are some words that are associated with digital library: library of congress, dictionary, institutional repository, data, digitization, pda, library, printing, bookshelf, bookcase, bibliophile, microform, bookworm, tome, textbook, handbook, bookmaking, sourcebook, susanna, 32mo, bibliomaniac, tobit, booker, dspace, bookstall, bookmaker, baruch, mook, esdras, necronomicon. You can get the definitions of these digital library related words by clicking on them. Also check out describing words for digital library and find more words related to digital library using ReverseDictionary.org

Words Related to digital library

Below is a list of words related to digital library. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to digital library:

library of congress dictionary institutional repository data digitization pda library printing bookshelf bookcase bibliophile microform bookworm tome textbook handbook bookmaking sourcebook susanna 32mo bibliomaniac tobit booker dspace bookstall bookmaker baruch mook esdras necronomicon scrapbook ecclesiastes koran eprints deuteronomy factbook storybook cyberlearning booklist bookie bookselling malachi bookhoard bookman booklet hardcover nehemiah paperback biography habakkuk
related words continue after advertisement
lbw copybook telelearning darpa bookseller bookhouse judith chapter sketchbook hardback bookbinder cyberbook nasa bookroom islandora bookhound bookrack biblio bookware coursebook bibliophilic bookable bookazine bibliomania bibliophilia bookmarker booklessness booky psalmbook bookaholic polygraphy bibliomaniacal fairybook incunable databook bookless bookmonger bibliolater bookly bookwise rebook bookling nonbook jotterbook webbook booklover midbook prebook passbook phrasebook booksy booklike heptateuch bipont shelfmark chansonnier erudition alluminor bookbus megaseller booklore chartbook hexateuch predictor benedictional octateuch intext special library underbook bookmobile bookful horologion bookend epilog bookhood delectus electronic media bookstand wishbook jotter bookjacket viewbook datebook talebook bibliomancy grangerite bookplate shopbook sendakian clipbook newsbook bibliotherapy doublure bookwork bibliopole informatics diabologue scorebook timebook codicology internet cybernetic intranet information retrieval cyber knowledge cybereducation computer telnet learnedly cyberinformation internalization born-digital cpu minicomputer microprocessor lore login microcomputer erudite supercomputer larn motherboard mainframe vm unlearn processor book and magazine bios cybernetics reference book e library peripheral digital commons find in library teletype antivirus modem teleinstruction fedora commons at library cybersavvy at bookstore children's book cybersociology rootkit cybertechnology book store source of information paperback book cyberpsychology cybersystem overlearn lend library cyberterrorism cyberjunkie telecommuter online public access catalog cybernetwork for read e book cookery book google relearn autolearning double book cyberintrusion in library trade paperback cyberinteraction be read antilearning learnedness diskette cyberphilosophy learningless cybersuicide bel and dragon ben sira fun to read arxiv multinetworked multinetwork cybergeneration read material publish ibt downloader cyberjargon non fiction many page card catalog field guide wisdom of solomon book club vade mecum many word outlearn order book be stain your room very rare neurocomputer spiral bind softmodem learnable coffee table book appender precomputer get onto web extranet ii chronicle i chronicle anticomputer be tear book scorpion phrase book computeritis employee handbook book of dead computerologist noncomputer nanocomputer book lung tv guide microlearning computerist resolve dispute compy computerology computernik computerdom education resources information center on shelf make from paper telecomputer tachistoscope computerbased trade book compunications puter read like book uploader ex libris screensaver computercide computerism document type hostmaster ibook netzine computerlike lere sneakernet interknowledge national science foundation fore edge report news pessimize pass on knowledge polyhistor metaprogramming memex information process logon computerize cyberfuture cybernews print paper cyberstudent cyberimmortality knowbot cyberdating must read book end report event paper page wardialer biocuration search engine biocomputing book keep book agent incrementor hackathon techie transputer table of content run headline virtualize address book pseudocode public library song of song vannevar bush go on internet as we may think surf web information superhighway surf net neural network peripheral brain digital data access internet information age hybrid library e education machine readable word process stream video american memory find information piece of information connect to internet data process get smart metadata very important wave clip log on log in database management system get computer have computer digital communication organize information learn event tv tuner sitemap surf internet data path graphic card internet archive web server digital computer in observatory download manager data converter command line interpreter computer aid design von neumann machine have open mind turing machine dumb terminal information theory analog computer central process unit digital public library of america become enlighten memory chip content management system computer hardware virtual reality in your room turn on computer configuration section computer graphic molecular model computer science expansion slot chiclet keyboard process information escape key spread information acquire knowledge machine code self learn home computer buy computer computer system write email computer circuit at internet cafe killer poke see exhibit human readable computer architecture personal digital assistant attend school electronic device visual display unit yahoo! open access emulated scirus item byte atm print ana hand colon thu sampling song read oxford text archive information input index database archive gate folio art end evidence text focus file catalog title portal cusp issue records user note enter book document reference reach menu directory here one set format number west paragraph place source almanac store field statistics threshold open line ramp deposit documentation run software era stack virus aim access record collect thumb rom medline date cpa score door entry head memory collecting mac register sort yearbook levee plate stop table port databases gathering amazon electronic brain z39.50 million book project optical character recognition copyright oai-pmh corporation for national research initiatives university of california, berkeley deep web panopticon web crawler terabyte open archives initiative protocol for metadata harvesting google scholar search engine indexing facial recognition automatic face recognition signature recognition face recognition floppy disk virtual machine fair use internet browser hard drive public domain project gutenberg proxy server title 17 of the united states code copyright act of 1976 digital rights management digital millennium copyright act full text search

Popular Searches

Words Related to digital library

As you've probably noticed, words related to "digital library" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "digital library" are: library of congress, dictionary, institutional repository, data, and digitization. There are 553 other words that are related to or similar to digital library listed above. Hopefully the generated list of digital library related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like digital library may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is digital library?

Also check out digital library words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of digital library themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr