Ide Related Words

examples: winterunderstandingcloud

Here are some words that are associated with ide: amino, carboxyl, iodide, carbonyl, arsenide, tetrachloride, monomer, methylene, hydroxide, diazo, isomer, compound, dimer, anhydride, organometallic, halogen, peptide, amine, thiol, nitrile, aldehyde, nitride, oxide, molecular, amide, diene, pyridine, alkyl, synthesis, fluoride. You can get the definitions of these ide related words by clicking on them. Also check out describing words for ide and find more words related to ide using ReverseDictionary.org

Words Related to ide

Below is a list of words related to ide. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to ide:

amino carboxyl iodide carbonyl arsenide tetrachloride monomer methylene hydroxide diazo isomer compound dimer anhydride organometallic halogen peptide amine thiol nitrile aldehyde nitride oxide molecular amide diene pyridine alkyl synthesis fluoride nitro organic superoxide coenzyme polymer ph aryl bromide amidogen ketone hydroxyl indole isomeric valent heterocyclic styrene molecule univalent chemistry acyclic azo unsaturated intermolecular radical epoxide catalyze chemically
related words continue after advertisement
trioxide aza oxidation monad phenol aliphatic methyl enantiomorph cyanohydrin halohydrin siloxane oligomer clathrate spectrochemistry nitrol dichloride quantivalence deutoxide phosphazene tetrathiafulvalene heterocumulene alkalamide halogenation heteroallene monoterpene cyanocarbon trichloride stereogenic trivalent halogenated tetrazone flavone triazine carburet hydroxybenzoquinone pyrrole hydroxyanthraquinone noncompound exotherm nitrosamine geminal tetrahydroxyanthraquinone decompound sulfone carboxide dinitrogen furan bisphenol bivalent quinoline alicyclic episulphide diarylethene dihydroxyanthraquinone halomethane episelenide oxime monopotassium oxamidine chlorofluorocarbon monovalent combinatorial hexacid delocalize nitrogenize compoundable sulfurette nitroparaffin pentachloride trihydroxyanthraquinone thiazole dyad triterpene thiophene magnetochemistry sesterterpene delocalization hemiterpene electrofugal monochloride actinide polyvalent solvate polymerize piezochemistry carbochemistry protosulphide glycochemistry dihydropyran radiochemistry heteroradical diterpene bimolecular arsinine chemosynthesis hydrosulfide sesquioxide phosphinine trifluoride amphoteric sulphamic acid functional group molecular mass acyl halide dissociation reaction homologous series inorganic chemistry general formula organic compound clathrate compound chemical decomposition dicarboxylic acid carbon disulfide parent compound acid anhydride isotopic chemistry lewis base hyphenate compound recombination energy binary compound transition element amino acid equivalent weight carboxylic acid nid tas vers nis ely ure charles regis henry fletcher cro rees ron ock tex ens liv ech allen thompson sheffield ted ida murphy fis remo roy ral nand samuel brin tha andre oliver simon shaw tro lewis cle bos rea donnie gary int sna nts ved pos bolton wayne howard gilbert torres anderson steve atkins clu bbc warwick tes keane davies denmark walsh minn hansen david lod robinson sig harrison ait sar carl eto edward ble swansea soc sed allan conn martin pid brighton birmingham cate francis paul sam blake chemical fingerprint organic chemistry glyceric acid straight chain gluconic acid silicic acid nuclear chemistry inorganic polymer molecular entity phthalic acid polychlorinated biphenyl isotope exchange lewis acid atomic mass double bond inorganic compound rydberg molecule chemical compound cks orts obj nks addr lls ethe sess felly

Popular Searches

Words Related to ide

As you've probably noticed, words related to "ide" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "ide" are: amino, carboxyl, iodide, carbonyl, and arsenide. There are 294 other words that are related to or similar to ide listed above. Hopefully the generated list of ide related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like ide may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is ide?

Also check out ide words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of ide themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr