Ig Related Words

examples: winterunderstandingcloud

Here are some words that are associated with ig: antibody, immunoglobulin, protein, antigen, iga, ige, igg, igm, metall, igd, enzyme, immune serum globulin, immune gamma globulin, immune globulin, polypeptide, chromosome, neurotransmitter, cytosol, farben, cholesterol, pancreas, metabolism, alanine, lysis, proline, nucleolus, chromatin, organelle, hemoglobin, receptor. You can get the definitions of these ig related words by clicking on them. Also check out describing words for ig and find more words related to ig using ReverseDictionary.org

Words Related to ig

Below is a list of words related to ig. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to ig:

antibody immunoglobulin protein antigen iga ige igg igm metall igd enzyme immune serum globulin immune gamma globulin immune globulin polypeptide chromosome neurotransmitter cytosol farben cholesterol pancreas metabolism alanine lysis proline nucleolus chromatin organelle hemoglobin receptor recombinant dna toxicity prion extracellular virion eukaryotic biospecimen genetic protoplasm cytoplasm cell gene diploid cysteine aib erythrocyte ipi haploid histochemistry
related words continue after advertisement
intracellular intercellular undifferentiated druggists atriopeptin inoculation vacuole hormone cpm coenzyme cbi epp bacterium abb unicellular urs meister cellular zygote chemotaxis histadrut lysin tissue serology proteid accc mizuho wiener kinesiology erste monad vishwa corus osmosis multicellular fibrin glutamine biochemistry minicell cytoskeleton rna cytology iea organism etzion telomerase organo holger shapira glencore cytochemistry iaa importin immunoglobulin g human gamma globulin gamma globulin immunoglobulin a immunoglobulin e immunoglobulin d immunoglobulin m tetanus immunoglobulin tetanus immune globulin cgt hilmar bau avraham nlc steroid vesicle energid wouter catalyze corporeal okazaki jeroen christer fels mitochondrion danske chemie arbitrator dresdner christoph parishad histology ppf bodily nucleus microorganism bacteria stereochemistry antiporter myonucleus replisome coagulation enchylemma cyte cellmate electropositive nuclear biochemical peptide membrane metalworkers molecule molecular synapse prokaryote mesoderm pathogen musculature polyploid commensal fission commerzbank neurobiology autolysis tetraploid blastema bergbau medef oligodendrocyte raghuram zwickel parthenote acellular zeitler akaryocyte neuroanatomy envisioneering bundesbank regulome arthrospore chemotroph eukaryote disomy lysosome welteke cytoplast nuclein microcell cybrid resler juergen nucleoplasm cellularity extranuclear anucleate mrg antiport cges dehlvi macromolecule hde stihl chemo i.g. cytoarchitecture issing macrocell kctu heterolysis otmar hvb phagocyte icmi ufj kriegler thyssenkrupp westlb brusca hideyuki loynes smmt tietmeyer nucleonics enderle kaleem fukaya dkb koenigsegg jbc nucleate laitenberger karyology liquidators bivalent boskin polyvalent redeker vereinsbank jerram steegmans holtzbrinck cees immunochemistry organismal chatikavanij vda tokofsky elseneer primordium sipri rzb zemsky lereah cardillo treichl bhf mcalinden nucleo essential amino acid pronucleus iatrochemistry biomolecule heterotroph anticatalyst saprophyte zoochemistry nonessential amino acid adenosine triphosphate body substance t cell fat cell blood cell somatic cell amino acid red blood cell nerve cell fuel cell dod conf cell division voltaic cell cell membrane chemical shift side chain germ layer gaucher's disease leydig cell monoclonal antibody polar body genetic material ribonucleic acid immune system cell theory stem cell aspartic acid nuclear matrix peptide nucleic acid endoplasmic reticulum white blood cell lymphatic system daughter cell nervous system terrorist cell nuclear physic nucleic acid organic chemistry animal tissue krebs cycle connective tissue chemical biology molecular biology physical chemistry generative medicine uric acid autonomic nervous system computational chemistry slime mold rsv genetics ca interferon proteins mab g antibodies ag j tt s ie heme isotypes ctla4 exenterate 10 6 67 globulin 32 31 3 20 2 13 1 63 62 immunoglobulins

Popular Searches

Words Related to ig

As you've probably noticed, words related to "ig" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "ig" are: antibody, immunoglobulin, protein, antigen, and iga. There are 346 other words that are related to or similar to ig listed above. Hopefully the generated list of ig related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like ig may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is ig?

Also check out ig words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of ig themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr