Lsd Related Words

examples: winterunderstandingcloud

Here are some words that are associated with lsd: timothy leary, albert hofmann, central intelligence agency, mescaline, hallucinogen, psychedelic drug, lysergic acid diethylamide, psychosis, drug, ergot, micrograms, delusion, ergoline, ergotamine, cocaine, dose, psychiatry, benzodiazepine, pharmacology, psilocybin, morphine, psychoactive, pcp, switzerland, antidepressant, gelatin, acid, antibiotic, antiviral, antihypertensive. You can get the definitions of these lsd related words by clicking on them. Also check out describing words for lsd and find more words related to lsd using ReverseDictionary.org

Words Related to lsd

Below is a list of words related to lsd. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to lsd:

timothy leary albert hofmann central intelligence agency mescaline hallucinogen psychedelic drug lysergic acid diethylamide psychosis drug ergot micrograms delusion ergoline ergotamine cocaine dose psychiatry benzodiazepine pharmacology psilocybin morphine psychoactive pcp switzerland antidepressant gelatin acid antibiotic antiviral antihypertensive chlorine entheogen injectable fungus penicillin hyperthermia blotting paper flashback mind control project mkultra therapy cannabis tylenol
related words continue after advertisement
heroin lucy in the sky with diamonds alcoholism hallucinogen persisting perception disorder 5-ht2a receptor chirality counterculture tryptophan tartrate chromatography hallucinations lysergic acid sublingual sugar psychedelic addictive anxiety paranoia oxygen ultraviolet sandoz psychiatric indication elvis pane dot zen superman gpcr oligomer insanity sacrament civilization appetite therapist hypothermia richard alpert saliva mucus tremor animated sense emotion memory awareness schizophrenia battery-acid echo dissociation prodrug druggist mydriasis codeine hallucinogens pharmaceutical suggestibility anticonvulsant mdma hyperreflexia antibacterial anticholinergic amphetamines antihistamine invasion hallucinogenic mutagenesis pharmacist anticoagulant medicine pharmacy placebo nondrug amphetamine antidrug immunology medication paregoric snorting analgesic eyedrop phosphene apc biomedicine aspirin arsenical diazepam sedation gastroenterology antisyphilitic synaesthesia insulin recreational drug use anesthesiology ecstasy narcotic rheumatology downer oncology communism acetaminophen oral administration radiotherapy purgative therapeutic dispensary tachycardia laxative atropine opium dope laudanum unapproved peptic prescribing neurology ketamine nostrum curative infusion nonspecific catatonic stimulants gynecology transformation postdrug pediatrics urology pills remedy receptor clinician panacea medical nephrology medic pharmaceutic snort palliative anticancer wonderdrug dopaminergic hypnosis refractory infuse abortifacient apothecary tiamulin allopurinol dermatology dmt antidiarrheal methamphetamine carminative opiates gemfibrozil painkillers probenecid pentylenetetrazol pharmacon antispasmodic experiment chemical synthesis antidiabetic disulfiram acyclovir methadone opiate performance-enhancing antiemetic overdoses penicillamine premedication antidepressants decongestant isosorbide expectorant isoproterenol beatles binge steroids uterotonic meth narcotize marijuana quinine naltrexone physostigmine barbiturates hypnotism medicate ghb steroid amrinone harvard cross-tolerance antipyretic prozac chemical warfare hematinic melatonin couriers corked clofibrate antiprotozoal drugs precursors ingesting overdose crosstalk sucralfate vermifuge antiarrhythmic experimented antitussive antibiotics youth culture vermicide chemotherapeutic potentiation immunosuppressant caffeine western world medicative prescribed agonist antipsychotic medications medicament psychomedicine papaverine anabolic counterculture of the 1960s ingested ricin addict parenteral anticholinesterase azathioprine prohibition of drugs antidiuretic neurotropic clonic proctology zymosis lorazepam neuropsychiatry suppository nonprescription clinical practice aesculapian europe australia street drug psychodelic drug hallucinogenic drug psychology loony toons window pane controlled substance back breaker drug of abuse premedical venesect mfm bronchodilator neuroleptic out of body traumatology leechcraft haloperidol ethnomedicine urinalysis podiatry league for spiritual discovery rhabdomyolysis counterirritant pseudomedical owsley stanley nonmedical stanislav grof empirical research valium pressor sacred scriptures anticoagulants noninvasive vasoconstrictor achromia vasodilators tranquilizers oxytocic sympatholytics polychrest carbon psychedelics antimalarial blood sugar nanomedicine isomer iatrophysics goose bumps unguent rubefacient digitalize phytomedicine nosology base succedaneum mental illness recreationally acid trip statin fluorescent set and setting prednisone anti-malarial ego death zoloft hgh eidetic imagery salbutamol lysergic cokes andro placebos anti-hiv anti-cancer benzedrine sulfa hydrolysis xanax quaaludes therapeutically androstenedione oseltamivir cognitive shift dhea haldol deet religion motion aftereffect fertility drug anti-depressant 2001-03 inhalants after image methamphetamines control substance form constant eye drop panic attack epsp bad trip darpp-32 lsd and schizophrenia d2r drug addict posttraumatic stress disorder mental disorder stereocenter national survey on drug use and health brand name drug hippie indole united states department of defense psychoactive drug cure illness retrosynthesis nucleophile do drug alcohol deprotonation diagnostic and statistical manual of mental disorders edta triboluminescent laboratory animals prescription drug uterine contraction basel diethylamine herbal medicine anti inflammatory magic bullet muscle relaxant drug ride dru adown pfizer parkinson amyl effet midmost yerba keto lod soma unk atkins senna mol saturn roche bromo alkaloid royce bellevue durante cun hcl frae xavier allyl conformer coram digitalis walgreens glasgow belladonna nux vomica histamine blocker downregulation and upregulation over counter drug outer space cold medicine patent medicine calcium blocker positive reinforcement lipid lower medicine illegal drug drug therapy drug cocktail forensic medicine preventive medicine ergine aldous huxley medical science internal medicine milligram group practice medicine chest in medicine cabinet california nuclear medicine endotracheal intubation emergency procedure retail pharmacy medicine man lability epimerisation alternative medicine carboxamide complementary medicine space medicine ally health g protein-coupled receptor medical topic enamine emergency medicine dopamine receptor adrenergic receptor dopamine receptor d2 5-ht receptor san francisco 5-ht3 receptor 5-ht4 receptor molar concentration kaleidoscope 5-ht1a receptor london 5-ht2b receptor 5-ht2c receptor 5-ht5a receptor 5-ht6 receptor amoxil piperazine lunesta klonopin reserpine terazosin quinoline valerate yohimbe chlorpromazine cytochrome chlordiazepoxide librium muscaria xanthine methylenedioxymethamphetamine pentazocine sulfonamide quat dilaudid 5-ht5b receptor cocain fosamax bitartrate yohimbine benadryl hyoscyamine safrole isobutyl rohypnol propyl provera adhd freebase hyoscine percocet hydroxybutyrate motrin hydroxyzine aneath sinsemilla sobeit pueraria diacetylmorphine adderall rogaine thiourea damiana nitrazepam medroxyprogesterone autoradiography methaqualone lomotil retin donovan receptor antagonist functional selectivity signal transduction new zealand united states phospholipase a2 phospholipase c glutamic acid cerebral cortex cell signaling depression optical isomerism absolute configuration sitar tabla distortion uv light ralph metzner panning phasing phosphoryl chloride reverb peptide coupling reagent theremin hipgnosis agar plate ipomoea toxicity chromosome morning glory methodology confusion vomiting tablet psychotherapy criminals canada imprisonment addiction stress tibetan book of the dead black market alexander shulgin covalent bond aromatic hydrocarbon drug test wah-wah backmasking rock band amyl nitrite glycyrrhiza glabra amphetamine sulphate ketamine hydrochloride st john san jose tricyclic antidepressant carboxylic acid united states president's commission on cia activities within the united states alfred matthew hubbard alan watts 2,5-dimethoxy-4-iodoamphetamine 2,5-dimethoxy-4-chloroamphetamine ergotamines 2,5-dimethoxy-4-bromoamphetamine 2c-c self-acceptance excipient 25i-nbome arthur koestler food and drug administration merry pranksters grateful dead ken kesey acid tests tom wolfe the electric kool-aid acid test the grateful dead jefferson airplane big brother and the holding company rock music rick griffin victor moscoso bonnie maclean stanley mouse alton kelley wes wilson michael hollingshead acid rock chelsea, london storm thorgerson side effect keith richards paul mccartney john lennon george harrison the beatles the rolling stones the moody blues the small faces pink floyd jimi hendrix itchycoo park sgt pepper's lonely hearts club band disraeli gears peter blake martin sharp hapshash and the coloured coat nigel waymouth michael english the fool psychedelic music psychedelic rock audio feedback music loop psychedelic art psychedelic literature psychedelic film united nations multidisciplinary association for psychedelic studies controlled substances act terminal illness control groups turbina corymbosa argyreia nervosa oscar janiger psychedelic therapy model psychosis convention on psychotropic substances heffter research institute cluster headache beckley foundation united kingdom concord, california standard for the uniform scheduling of medicines and poisons western australia controlled drugs and substances act tim scully misuse of drugs act 1971 royal college of psychiatrists organic chemistry chemical diversion and trafficking act schedule iii united states supreme court runciman report drug enforcement administration transform drug policy foundation

Popular Searches

Words Related to lsd

As you've probably noticed, words related to "lsd" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "lsd" are: timothy leary, albert hofmann, central intelligence agency, mescaline, and hallucinogen. There are 711 other words that are related to or similar to lsd listed above. Hopefully the generated list of lsd related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like lsd may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is lsd?

Also check out lsd words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of lsd themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr