Ore Related Words

examples: winterunderstandingcloud

Here are some words that are associated with ore: mineral, metal, mining, iron, minerals, iron ore, smelting, copper, gold, krone, rock, refining, nickel, mines, mine, coal, steel, ferrous, cobalt, uranium ore, zinc, ferromanganese, bauxite, deposit, mill, manganese, smelter, uranium, metallurgical, chromite. You can get the definitions of these ore related words by clicking on them. Also check out describing words for ore and find more words related to ore using ReverseDictionary.org

Words Related to ore

Below is a list of words related to ore. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to ore:

mineral metal mining iron minerals iron ore smelting copper gold krone rock refining nickel mines mine coal steel ferrous cobalt uranium ore zinc ferromanganese bauxite deposit mill manganese smelter uranium metallurgical chromite magnesite potash molybdenum alumina tailings sulfide pig iron blast furnace niobium subunit krona concentrate paco scoria platinum metallic bimetallic silver metallo metalcore wolfram silversmith pewter argent chalybeate silvery
related words continue after advertisement
argentine pyrargyrite coppery bronze coppersmith metalloporphyrin bullion tinsmith metalliferous mettle orichalcum alloy polybasite ferric cyanidation tetrahedrite aerugo tin ferrometal metallodrug metallically cementation neogen metally intermetallic metallism nibral metaller ferrokinesis radiometal goldfield unmetalled liquation pinchbeck sterrometal alnico metallike rust argentiferous caracoly metalsmith oroide silversmithing ores ferroalloy platinoid fertilizer desilverize silverish argyr silverness sylvanite silverly electrum metallography coking occamy argentite ironmaker acierage invar freibergite metals quartation smithing silvertone cupric ferrovanadium ferrotitanium bimetal ferroboron cermet oil aluminium armoursmithing mined silverbill argentic tennantite lametta grain cement argentous milling speiss tombak pit silvern stannite niello petroleum steelie silverweed extraction oxide maravedi sweepwasher slurry skaergaardite petrukite sakuraiite weishanite galvanise xingzhongite mineralizer tinny pearlite fossil bitumen timber tsnigriite silverite tonnes deposits crude tons wheat miner phosphate goldsmithing fertiliser hocartite toyohaite metalline lumber austenite aurous gas stannary fischesserite extracted muthmannite gravel goldless martensite proustite monometallism cylindrite penzhinite silverless yamboo extracting hydrometallurgy plutonium lignite shale sugar aluminum titanium hydroelectric feedstock ammonium refinery flour smelters gypsum quarry exporter ton placer bituminous petrochemical supplied fuel importer alkali plant extract sulphur supply raw dairy supplier quantities methane producing magnesium nitrate anthracite furnace oregon groundwater upstream smelted fertilizers bhp rudy norwegian krone danish krone dressed ore lead ore swedish krona fractional monetary unit pay dirt hour magnetite sulphide tonnage kimberlite zircon mineralization moly gravels laterite hematite vanadium barite nepheline rutile dore feldspar lodes fluorspar tungsten alluvium dolomite pgm adit breccia silver mine coltan hard substance cyanide process electrical conductor earth noble metal chinese silver homestake nickel silver gold mine silver sulfide copper group sterling silver tea tray yanzhou silver medalist open-pit galvanic anode use in construction free mill silver medal rose gold precious metal cvrd crust bell metal britannia metal flat silver vermiculite biddery ware mannheim gold ash grey green gold phosphor bronze bessemer steel silver plate anode slime heavy metal orebody ilmenite stope saprolite haematite spodumene hypogene colluvium calcine gossan supergene limonite electrowinning beneficiation detrital tantalite opencut eluvial sinter cold work wollastonite scheelite wolframite glauconite ferrochromium polyhalite molybdenite bronzewing stibnite carbon ferrous taconite gangue winze unalloyed metal speculum metal muntz metal babbitt metal tula metal soft metal make jewelry silver fox boron group gamma iron valuable metal strong metal white gold delta iron carbon steel philosopher's stone wrought iron austenitic steel christian metal tin plate gold medal stainless steel geology alloy steel tin snip tin bath wood's metal press clothe silver wed extractive metallurgy ore genesis sulfide mineral silicate minerals froth flotation vanadium pentoxide mineral resources native copper lithium antimony bismuth tantalum nymex kambalda type komatiitic nickel ore deposits london metal exchange new york mercantile exchange world bank rare earths

Popular Searches

Words Related to ore

As you've probably noticed, words related to "ore" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "ore" are: mineral, metal, mining, iron, and minerals. There are 389 other words that are related to or similar to ore listed above. Hopefully the generated list of ore related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like ore may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is ore?

Also check out ore words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of ore themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr