Simple sentence Related Words

examples: winterunderstandingcloud

Here are some words that are associated with simple sentence: sentence, clause, syntax, subject, dependent clause, verb, phrase, word, verb phrase, adverb, term, prepositional phrase, noun, sentential, independent clause, adverbial, compound imperative, monosyllable, motto, wordy, main clause, troponym, polyword, holonym, loanword, wordish, meronym, unworded, wordwise, nonlexical. You can get the definitions of these simple sentence related words by clicking on them. Also check out describing words for simple sentence and find more words related to simple sentence using ReverseDictionary.org

Words Related to simple sentence

Below is a list of words related to simple sentence. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to simple sentence:

sentence clause syntax subject dependent clause verb phrase word verb phrase adverb term prepositional phrase noun sentential independent clause adverbial compound imperative monosyllable motto wordy main clause troponym polyword holonym loanword wordish meronym unworded wordwise nonlexical hyponym phrasal wordness disyllable trisyllable wordfinal byword definiendum misword interword polysyllable proparoxytone reword wordhood wordinitial lexical verbal catchword
related words continue after advertisement
barytone monosyllabic anaphor listeme content word synonym wordable paroxytone wordless wordaholic oxytone syllabify syllable deictic verbally antonym lexeme p word unaccented verbalist averbal nonce word catchphrase reduplication negative interference headword set phrase attributive svo quadword partword lexical word blanket term function word subordinate clause intransitive verb b word wordnet mean thing quantifier parenthesis dword antiverbal h word lexical item latinism n word ur word fight word calligram string of word anagram foreword wordcraft participle give voice wordstock coverb dirty word idiom hispanism indianism terminology morpheme philological pseudoword predicative illative noun phrase lexicon phrasal verb lexicology grammatical hypernym substantive modifier garden path sentence swear word f word comitative transitive verb phraseology infinitive pronunciation vocabulary formulation logograph qualifier propositional function abessive verbal noun heterogram paraphrase disapprobation lexical semantics nominalism loan translation thesaurus overword epenthesis sinicism expletive preverbal formula antimetathesis watchword logo hinglish elision verbalism translative maxim encyclopedic onym safeword ineffable postmodify catachresis hunglish part of speech vocable wordbuilding logology utterable codeword nym convict frenchism heteronym janglish reduplicate kilobyte subvocalize alphagram metonym frankenword determiner object language spellingly run speech boot verb four letter word plural noun hurt feel anagram dictionary passive vocabulary question nothing one grammar merely person sentences argument rather a given any case instance terms means same manner execution kind or without punishment unusual example requires sort no explanation an usual another certain appropriate makes exception instead meaning actual applies appeal gives answer proof essentially method either comes involves usually straightforward procedure this reasonable description sometimes not simply mean legal reference conviction proper making similar describing if only giving self consider charge less typical perfect full follows matter interpretation setting particular takes judgment exactly formal fact yet but even basis longer is stand actually often choice specific predicate condemnation idiomatic keyword charade hybridize inarticulate americanism dependent traditional grammar wordmonger wordsmith aphthong polysyllabic wpm coordinating conjunction analysis disjunction hobson jobson term of endearment key word adjective catch phrase alpha privative cell bit bits brief catch complex construction declarative diagram dots adage doy shorthand short sequence phase make mak lines like life ido dpt rune pains condemned read power heads head compound complement analytic tone edited tree dota perpetuity clean classical clack amplification amnesia alleviated achene abridged abc abacus cinch church conjugate chronicling chronicle chicane corruption chaste characteristic ceremony congregation catabolism canna condensation concept bulgaria broke breeze bound bosh bore blt club block beatrix beard basic banded band ball badge average clear ask are compound verb comma splice conjunction object subordinating conjunction atticism aak cakewalk caltrop cavatina anabolism aang annulet appressed chemolysis english grammar adverbial clause relative clause restrictive relative clause block letter predicate nominative subject complement prescriptive grammar

Popular Searches

Words Related to simple sentence

As you've probably noticed, words related to "simple sentence" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "simple sentence" are: sentence, clause, syntax, subject, and dependent clause. There are 416 other words that are related to or similar to simple sentence listed above. Hopefully the generated list of simple sentence related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like simple sentence may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is simple sentence?

Also check out simple sentence words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of simple sentence themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr