Sound Related Words

examples: winterunderstandingcloud

Here are some words that are associated with sound: noise, voice, music, vibration, ultrasound, compression, drum, audio, fathom, air, loud, acoustics, phone, ear, psychoacoustics, longitudinal wave, loudness, solid, decibel, cacophony, transverse wave, water, quaver, ring, roll, ting, vibrato, gurgle, tinkle, chirrup. You can get the definitions of these sound related words by clicking on them. Also check out describing words for sound and find more words related to sound using ReverseDictionary.org

Words Related to sound

Below is a list of words related to sound. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to sound:

noise voice music vibration ultrasound compression drum audio fathom air loud acoustics phone ear psychoacoustics longitudinal wave loudness solid decibel cacophony transverse wave water quaver ring roll ting vibrato gurgle tinkle chirrup vroom whir twang clink zing skirl tootle whirr noisiness peal susurration patter jingle strum jangle toot thud channel tone purr paradiddle beep pop buzz ping song bleep wave mutter mechanical phenomenon long island sound whistle
related words continue after advertisement
chorus echo go good legal profound intelligent heavy reasoned healthy acoustic levelheaded well-grounded wakeless vocalize sound property auditory sensation speech sound pressure thrum thump clangor tintinnabulation blare liquid stereo gas soundscape infrasound transmission medium melody hum vacuum wind screech stereophonic unison percussive molecule unsound strong velocity sense white noise speed of sound steel strait effectual hertz timbre physics hearing level-headed vocalise media physiology psychology shear stress look whirring tick thumping video phonetics birr clump chirk throbbing say tapping utterance pronounce swish enunciate sigh vocalization television whack narrow appear trampling trample dub ringing skagerrak dardanelles quack waver popping plunk phoneme rolling vowel glide pealing tap rap pat whiz muttering murmuring measure murmur knocking knock consonant gargle step tv footstep footfall dripping drip ding cry clumping ticking whistling bosporus happening occurrence bong sensation euphony articulate racket twitter chirp click chink quantify beat dissonance toll bell resound sounds soundless clatter cymbal speech sonorous tweeter whizz soundness resonate din audible clang clack clank resonant noisily unresolved kattegatt bombination clopping bombilation clop rataplan enounce skagerak drumbeat racketiness clippety-clop clip-clop occurrent aeroacoustics thunk sonant orinasal aesthesis semivowel hellespont esthesis susurrus rub-a-dub zizz click-clack mussitation solent clunk murmuration clunking telecasting diaphragm rustle sonic squelch aloud squeak reecho bioacoustics deep rumble lude reflection tune clamorous overnoise obstreperous refraction sounding instrument soundproof soundwise missound supersound attenuation outnoise rhythm dissonate noiselike thunder deafen refracted outsound hypersound soundable boom stridulation noisy soundlike voiceful thunderous instrumentation whish hiss rhonchus bruit soundage guitar touch melodic rock loudspeaker noisemaking grunt antinoise uproarious soundalike visual thunderer musical glug light soundscore little noiseless loudly plasma instruments creak listening voicism voices performance ticky rattle songs kind scrunch direction very rhythms it recording vociferous lyrics barbarous bit hubbub reard piece swoosh sounded rather well ambient thunderclap soundtrack quite japanoise way earshot honk vocal makes sometimes vocals resoundingly clamour mechanical wave version melodies kerplop band original similarly kaboom features much slow hard signal uses pretty tunes mix sort soundworld swing tweet approach familiar entirely soulful similar studio so mind eardrum riffs simple heard bang done particle displacement quality combination instrumental something soul audibly unusual singing example soundbank motion this groove like cool often background raucous voicist incomprehensibility tintinnabular guggle soundex sonorant rarefaction pitch radio twank stridor yarm strain acoustical engineering aurally heptachord audio engineer frequency queen charlotte sound strait of gibraltar body of water canakkale bogazi east river bering strait cook strait golden gate korea strait korean strait menai strait north channel strait of georgia strait of hormuz sense datum sense experience sense impression pure tone auditory communication language unit linguistic unit strait of ormuz strait of magellan puget sound sound out drum roll strait of messina pas de calais strait of calais strait of dover strait of malacca natural event voiced sound orinasal phone vowel sound torres strait clomp chroneme thundersquall hydrophone intonate stertor audio signal processing hoopla subtonic phonophobia architectural acoustics clip clop noisemaker audible sound thundery environmental noise vector palinacousis univocal soundpainting thunderburst phonomotor lovemobile musical acoustics fragor rubadub noise control sound system echo sound sequence click clack sound engineer attract attention polarization surround sound underwater acoustics vibrate air loud sound ansi/asa s1.1-2013 ratio density temperature celsius fahrenheit get someone's attention wave propagation sound wave near field ring of truth state of matter wah wah dynamic headroom sound off sound barrier astronaut stable talking valid reasonable dependable substantial complete righteous safe secure sensible soundly silent quiet silence noises trebly tocsin sonically muffled reverb backbeat synths synthesizers reverberation quadraphonic aural binaural moog wail droning sibilant monophonic growl acoustical descant dancy melodious harmonics second sound khz ding dong frequencies wave field synthesis species annoy someone flue pipe get attention stone ring out navigation new wave silent film predation mechanical equilibrium communication iron earth atmosphere anharmonicity fire devoice boomy tinny tinkly overloud throatier unmelodic claxon sibilance muzak clattery bleats hoofbeats glissando melodically listenable drumbeats flutelike handclaps rain sine wave earthquake plane wave standard temperature and pressure frog bird piano wave vector mammal organ octave human hydrosphere standard conditions for temperature and pressure pierre-simon laplace telephone adiabatic process square root duration texture bat dolphin pascal polyphony bulk modulus sea level parametric array percussive instrument ride cymbal hearing range a-weighting responsivity homophony defence mechanism physical phenomenon ocean surface wave marine mammals bird vocalization speech communication sound pressure root mean square doppler effect sound localization international electrotechnical commission pink noise human being

Popular Searches

Words Related to sound

As you've probably noticed, words related to "sound" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "sound" are: noise, voice, music, vibration, and ultrasound. There are 639 other words that are related to or similar to sound listed above. Hopefully the generated list of sound related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like sound may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is sound?

Also check out sound words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of sound themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr