Ebv Related Words

examples: winterunderstandingcloud

Here are some words that are associated with ebv: cytomegalovirus, cmv, murine, herpes, epstein-barr virus, medwin, epstein-barr, egfr, stes, ipv6, hexokinase, mutates, hhv-6, vzv, s1p, atomoxetine, hcv, camkii, htlv-1, self-fertilization, rastafarianism, ivc, dextromethorphan, herpes virus, hsv-1, lpe, wnv, jaffé, tmv, mram. You can get the definitions of these ebv related words by clicking on them. Also check out describing words for ebv and find more words related to ebv using ReverseDictionary.org

Words Related to ebv

Below is a list of words related to ebv. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to ebv:

cytomegalovirus cmv murine herpes epstein-barr virus medwin epstein-barr egfr stes ipv6 hexokinase mutates hhv-6 vzv s1p atomoxetine hcv camkii htlv-1 self-fertilization rastafarianism ivc dextromethorphan herpes virus hsv-1 lpe wnv jaffé tmv mram glucokinase g-csf hcmv stis hscs hppd 2-ag r1a mscs hiv-1 tommasi uii phosphorylating narth kshv r-m17 cyp2d6 ovl ngf bmp4 1630gmt tregelles cdk1 dephosphorylated xrf i.r. nmf hrdc hdlc h9n2 magallon
related words continue after advertisement
insar icad marcionism lcmv ibas nccs ipscs dstl thymidine plwha n.i. fiv sphingosine bdd wbut sqp i-131 isoenzyme ilbe l-dopa sibutramine pomc iium transglutaminase transmode öztürk cowpox mptp igd dsd phosphofructokinase psychokinesis ʻalī abct ccdac øivind löb rasulov ólafsson gvhd h3n2 gsk-3 diphtheria lpd veb antibodies antigen mirs prion mycobacterium genotype phage igm hydrolase eosinophils lymphocytes lymphoid igg mutation bacteriophage synthetase transmembrane monoclonal pca myeloid isomerase viremia granulocytes monocytic replicon syngeneic herpesviruses autoantibodies autoantibody adenovirus heterozygote trichinella virions hepatoma esterase scrapie francisella herv histocompatibility provirus homozygote viraemia osteoblast epitope thyroglobulin flavivirus orthopoxvirus proteolysis bacteroides immunoreactivity urease toxoplasma serologic chlamydial peptidase proband mosaicism corynebacterium isoleucine titer borrelia poxvirus osteoclast thyrotropin superinfection glycopeptide endotoxin endometritis staphylococci phagocyte meningococcus paramyxoviruses merozoite spermatogenesis proteoglycan htlv arginase homozygosity seroconversion endonuclease l. monocytogenes parainfluenza virus c. trachomatis leydig cell toxin antitoxin suppressor gene immunoglobulin g francisella tularensis herpes simplex virus purkinje cell b lymphocyte varicella zoster virus neisseria gonorrhoeae rheumatoid factor

Popular Searches

Words Related to ebv

As you've probably noticed, words related to "ebv" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "ebv" are: cytomegalovirus, cmv, murine, herpes, and epstein-barr virus. There are 195 other words that are related to or similar to ebv listed above. Hopefully the generated list of ebv related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like ebv may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is ebv?

Also check out ebv words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of ebv themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr