Ngf Related Words

examples: winterunderstandingcloud

Here are some words that are associated with ngf: aldosterone, inhibitory, nerve growth factor, bdnf, amylase, overexpression, egfr, correlates, elongation, excitability, hypothalamic, cytosolic, prolactin, fibroblast, innervated, vagus, multiplies, activator, bmp4, pepck, infectivity, igf-1, pdgf, affectivity, growth factor, glucokinase, insulin-like, neurotrophic, gfap, ampk. You can get the definitions of these ngf related words by clicking on them. Also check out describing words for ngf and find more words related to ngf using ReverseDictionary.org

Words Related to ngf

Below is a list of words related to ngf. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to ngf:

aldosterone inhibitory nerve growth factor bdnf amylase overexpression egfr correlates elongation excitability hypothalamic cytosolic prolactin fibroblast innervated vagus multiplies activator bmp4 pepck infectivity igf-1 pdgf affectivity growth factor glucokinase insulin-like neurotrophic gfap ampk p27 iih 5-htp upregulation hepatocyte ebv c-myc g-csf gm-csf nf-κb trkb rle erps sirt1 stimulators c-jun vwf p16 alpha-synuclein motional β-carotene ouc resistin her2/neu yahata dhfr hif
related words continue after advertisement
upregulate s1p stat3 2-ag neurogenic c-kit remanence neurotrophins ciit holan camkii adp-ribosylation steroidogenic up-regulation cyp3a4 vpg platelet-derived brain-derived desmin oxalates drobnic event-related inactivates survivin adiponectin her2 mscs wks tmds eco-costs lesioning neilsen egf matriclan ghrelin mtorc1 goif hypoperfusion elided gdnf p24 zpa cwd bdn pten mirs tnf dpp cytokine interleukin amyloid phospholipid decarboxylase estradiol tubulin mab glucocorticoid atpase excitatory superoxide platelet hippocampal cholinergic nadp sterol trypsin effector peptide mir catabolism axonal pth erk reductase telomerase androgens nicotinamide antibody 125i arginase osteoblast polyamine collagenase proteoglycan mitogen enos hematopoiesis ouabain catecholamine erythropoiesis smac luteolin plasminogen mucin isoenzymes thymosin auxin astrocyte neurites thyrotropin mineralocorticoid triiodothyronine somatostatin calmodulin osteoclast tetramer phagocyte corticosterone proinflammatory bradykinin myelination npy acetylcholinesterase eicosanoids mononuclear cyclooxygenase gastrin thromboxane motoneurons autoregulation spectrin oncogenesis tripeptide secretase nephron globin serotonergic spermatogenesis carvedilol isoproterenol noradrenaline glycosaminoglycan neuromuscular junction hemophilia b purkinje cell leydig cell angiotensin ii coagulation factor oxidative phosphorylation calcium ion glial cell tumor necrosis factor amyloid plaque

Popular Searches

Words Related to ngf

As you've probably noticed, words related to "ngf" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "ngf" are: aldosterone, inhibitory, nerve growth factor, bdnf, and amylase. There are 195 other words that are related to or similar to ngf listed above. Hopefully the generated list of ngf related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like ngf may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is ngf?

Also check out ngf words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of ngf themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr