Movie Related Words

examples: winterunderstandingcloud

Here are some words that are associated with movie: film, television, movie projector, soundtrack, picture, cinema, dvd, movie theater, celluloid, screenplay, film director, actor, show, documentary, scene, motion picture, filmmaking, telefilm, sequel, animation, film noir, movie screen, photographic film, studio, video, thriller, computer animation, flick, feature film, box office. You can get the definitions of these movie related words by clicking on them. Also check out describing words for movie and find more words related to movie using ReverseDictionary.org

Words Related to movie

Below is a list of words related to movie. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to movie:

film television movie projector soundtrack picture cinema dvd movie theater celluloid screenplay film director actor show documentary scene motion picture filmmaking telefilm sequel animation film noir movie screen photographic film studio video thriller computer animation flick feature film box office sound photography reshoot silent movie cinematography story shot documentary film skin flick episode sound film phi phenomenon film stock movie camera feature slow motion final cut musical martin scorsese
related words continue after advertisement
filmmaker actors home movie studio system pic kinetoscope theater entertainment video camera filmography picture show moving picture sitcom videotape moviedom talkie script movieland dramedy art cameraman silents computer-generated imagery bollywood remake horror oater genre fiction comedies sound recording and reproduction short subject theatre dialogue miniseries zoetrope preview propaganda film blockbuster film frame persistence of vision movie theatre movie star audience silver screen screenwriter film score magic lantern technicolor widescreen auguste and louis lumière sergei eisenstein advertising prequel communication movement culture projectionist dubbing subtitles cinematic translation take 3d sequence caption credit infotainment dub synchronize production shoot play docudrama tape credits subtitle product dances costumes movies filmy audiences suspenseful storyboards andrei tarkovsky photochemistry microfilm sound-on-film films comedy bioscope minimovie moviegoer cinematograph hollywood pix exposure filmic pellicle movielike midmovie projector matinee reel moviegoing drama videocassette preproduction movieverse synchronise three-d shoot-'em-up 3-d animated cinemagoing metafilm filmzine filmize nanofilm comic terminator photoplay motion-picture show moving-picture show filmdom polaroid filmlike parody piano organ tv shows orchestra spoof mockumentary theatrical phenakistoscope broadway reality disney character starring praxinoscope intolerance hbo best popcorn starred filmology filmstrip fantasy comic book acclaimed featured cartoon characters scenes film theory directed adaptation dramas productions stars filmed screen fun zoopraxiscope love filmgoing novel monster presents vcr funny cast tale musicals fandub ever cameo wonder theme adventure pop like featuring series crazy titled star imagine pictures goes premiere romantic filming directing joke gets book eastwood music stranger version art film film industry entertain titanic showmance visual effects vidcap entertainer extravaganza trekverse digital intermediate tv movie digital recording teleplay adult movie move picture cultural artifact burlesque science fiction movie filmwise semiotics scriptment showdown shoot em up cinemuck wittgenstein zombie autoradiograph suspense language producer popcorn movie showbusiness hatedom kinescope camcording undercranked undercrank recording medium trekiverse backdrop internet cinema verite coming attraction musical theater rough cut collage film silent picture talking picture musical comedy united states filmcoated screenwork counterpoint sticky floor set construction overexpose editing scriptwriting exhibitor teleshow opera superscreen ballet row of seat newspaper shrink wrap pageantry magazine mise en scène christiaan huygens filmable movie theatre space show movie fun to watch mumblecore freeze frame cable television preshow showie photographic emulsion closeup movie ticket compere photofinisher telerecording eadweard muybridge celebrity forthshow photographic plate supershow showable baby wrangler telescreen showlike overexposure mumbai chick flick stalkumentary film at 11 unfilmed hindi at theater woodville latham downstage sword and sorcery star trek tittytainment koster and bial's music hall new york city big picture film editing horror movie lobby card animatronics visual arts edutainment silent film loudspeaker theater box voice actor on television world war i cinema of the united states d. w. griffith artistic drive in movie the birth of a nation theoretical home video action movie technology commerce friedrich wilhelm murnau theater ticket fritz lang batman fade to black charles chaplin balcony seat buster keaton multiple exposure media maven talkies sound effects hearing plot moviegoers biopic filmmakers trilogy theaters helmer capote blockbusters beowulf porno cineplex plotline cinemascope featurette peckinpah kubrick imdb westerns auteur directorial double exposure color motion picture film anti fandom short film film set view audience india becky sharp variety show horse opera waterworld polarized 3d system stereophonic sound peter bogdanovich animate cartoon sound effect french new wave concession stand parallel cinema japanese new wave ice show shutter speed sales new hollywood ticket booth theater seat ricciotto canudo formalist film theory rudolf arnheim béla balázs body double siegfried kracauer sex scene puppet show on camera andré bazin theater company jacques lacan wide shoot ferdinand de saussure lemon drop psychoanalytical film theory cough button structuralist film theory stage curtain videocassette recorder feminist film theory movie theater seat analytical philosophy digital cinema actioner moviemaking romcom filmgoers weepie zinnemann boxoffice chayefsky filmgoer potboiler flic flim jumanji oaters soapdish form of life cineaste scifi stageplay television receiver james monaco metonym ingmar bergman screen test open credit title track warner bros. 180-degree rule film release ticket office classical hollywood cinema mozart music personal video recorder city symphony mise en scene metro-goldwyn-mayer movie house dramatic beat broadcast media camera film genre action film acetate horror film movie director comedy film drama film movie marketing film studies oberammergau passion play lens charlie chaplin budget audio engineer television programming multimedia videotape recorder hollywood, california analog cinema of india movie studio vhs download amateur fan license youtube dv firewire cult billboard mainstream camcorder cost overruns contract 1080p japan wajda academy awards blockbuster film mothlight film criticism film history film propaganda blu-ray disc movie review star wars action figures product placement polyester british and american english special effects silent films cecil b. demille mission impossible the brothers grimm fred zinnemann leap year sherlock holmes new moon william wyler indiana jones cop out kevin spacey paying guest skeleton key ron howard queer duck ang lee anthony hopkins josef von sternberg stanley kubrick hard candy butterfly effect oliver stone darryl zanuck match point love story steven spielberg the living dead dustin hoffman pitch black stan brakhage aspect ratio hanna-barbera dvd-video blu-ray veoh claymation independent film film screening projection screen double feature united artists bride of frankenstein james bond the godfather tony gilroy the bourne identity butch and sundance: the early days columbia pictures woody allen take the money and run post-credits scene ferris bueller's day off audience response paramount pictures educational film leni riefenstahl production cycle trade union film budgeting film base film format 35 mm film separation masters film preservation digital video television production television program independent animation animation camera stop motion broadcast syndication video on demand home entertainment film distributor ultra high definition television fan fiction film festival video editing software personal computer digital cinematography non-linear editing system digital projector the blair witch project high-definition video len lye norman mclaren osamu tezuka united productions of america limited animation 16 mm film

Popular Searches

Words Related to movie

As you've probably noticed, words related to "movie" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "movie" are: film, television, movie projector, soundtrack, and picture. There are 648 other words that are related to or similar to movie listed above. Hopefully the generated list of movie related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like movie may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is movie?

Also check out movie words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of movie themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr