Star Related Words

examples: winterunderstandingcloud

Here are some words that are associated with star: sun, galaxy, red giant, binary star, neutron star, white dwarf, supernova, milky way, superstar, hydrogen, radiation, nova, chemical element, helium, constellation, red dwarf, supergiant, gravity, sensation, black hole, night sky, star cluster, asterism, co-star, celestial body, heavenly body, stellar, asterisk, headliner, starlet. You can get the definitions of these star related words by clicking on them. Also check out describing words for star and find more words related to star using ReverseDictionary.org

Words Related to star

Below is a list of words related to star. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to star:

sun galaxy red giant binary star neutron star white dwarf supernova milky way superstar hydrogen radiation nova chemical element helium constellation red dwarf supergiant gravity sensation black hole night sky star cluster asterism co-star celestial body heavenly body stellar asterisk headliner starlet starring giant star convection player actor multiple star idol performer luminosity nebula earth hotshot planet betelgeuse plasma energy crab nebula proxima centauri leading deneb pollux spica regulus
related words continue after advertisement
nuclear fusion sterope lodestar denebola pentacle beta centauri star catalogue astronomical spectroscopy jupiter sirius double star star chart feature character mizar genius lead wizard prima principal ace virtuoso whiz whizz wiz adept maven astrology orbit costar astronomer stardom major metallicity vega canopus main sequence carbon oxygen globular cluster hipparchus ptolemy space velocity moon black dwarf stellar nucleosynthesis matinee idol degenerate matter chromosphere legend hero solar calendar celebrity brown dwarf ultraviolet rookie actress standout second x-ray parallax electromagnetic spectrum interferometer gamma ray proper motion iron champion orion nebula electromagnetic radiation starry mavin interstellar starless heat light starcraft astro fuel astral rigel radio cl microwave civilization pentangle pentagram execute dramaturgy hexagram variable binary dramatics have perform do mark astronomy giant thespian theatre theater expert topology graph planets procyon starship starly quasistar mesopotamia arcturus antistar starhood instar starfaring mass extraterrestrial hyades stellate antares capella sidereal pleiades asteroid stars altair starlike coronagraph exocomet polaris observatory zij galactic wanderstar quasar starquake polymath subplanetary sabianism fomalhaut gemma crater latitude bestar loadstar asterope uranology histrion grapheme andromeda comet photoevaporation refraction horoscope starburst conjunction astronomical unit interstellar medium planetary nebula stardust scorpius extragalactic intersidereal star topology aphelion democritus kassites epicurus deimos exoplanet gacrux phobos aristillus menkar timocharis algiedi dschubba starlore algol denebokab sporades planetesimal mirfak thuban nanostar alshain diphda saiph hamal pseudostar phecda enif kochab starproof plays elnath eltanin mintaka alphard alnitak alnilam albireo charon best alnair stellify zubeneschamali legendary zubenelgenubi played markab bellatrix playing alkaid dubhe hydrostatic equilibrium algenib fame movie triangulum hyleg al-andalus moonly veteran photograph play nibiru one golden alongside tv named newcomer featured players whose appearance show photoelectric debut talent another co star star designation top man film first pair winner angular momentum hollywood thermonuclear fusion protoplanet fan astrophilia starred sabaism title host quark star super fax star miss game soccer big ever oscar outer space williams basketball seastar lunisolar gets supernova nucleosynthesis team likes with young eddie favorite lineup as television series stellar mass knight featuring beckham nuclear reaction football real like winning johnny fix star ray shows multiple star system takes michael drama baseball comedy stellar evolution has spot mvp dwarf galaxy babylon davis hertzsprung–russell diagram games stellar wind looks ecliptic star formation career award gave boy pop a gravitational collapse trinary star sub brown dwarf mythology star system heat transfer age of the universe mercury venus mars stellar remnant planetary system judicial astrology saturn uranus light-years neptune lunar occultation 's stellar atmosphere celestial object celestial navigation heavenly sphere alpha centauri neutrino fixed star network topology plane figure two-dimensional figure track star tv star performing artist white dwarf star variable star television star red giant star film star red dwarf star alpha crucis beta crucis dramatic art role player graphic symbol movie star extragalactic nebula solar mass astronomical object star shell regulation famous person group of star gregorian calendar sunlight triangulum galaxy spiral galaxy egyptian astronomy photometer sidereal astrology babylonian star catalogues photosynthesis babylonian astronomy north star interstellar planet radius wander star barnard's star greek astronomy climate in universe far away weather ion in outerspace chinese astronomy summer triangle sn 185 cepheids beta canis majoris sn 1006 ali ibn ridwan deneb kaitos sn 1054 magellanic cloud neon burning process astronomy in medieval islam radioactive book of fixed stars persian people oxygen burning process abd al-rahman al-sufi orion's belt winter triangle omicron velorum satellite planet brocchi's cluster minor planet silicon burning process andromeda galaxy interplanetary space abu rayhan biruni proplanetary disk lunar eclipse termination shock concentration outer solar system ibn bajjah galactic halo planetary object tropical astrology islamic calendar interstellar space tycho brahe planetary body giordano bruno see at night extrasolar planet greek philosophy dwarf planet blue giant islamic cosmology other planet fakhr al-din al-razi neon isaac newton richard bentley geminiano montanari silicon edmond halley trillion ancient greece kilometre william herschel galactic center john herschel protostar joseph von fraunhofer angelo secchi year spectral line stellar classification annie jump cannon kelvin pulsar hunk phenom prodigy diva footballer beau supermodel popstar youngster cutie baywatch 61 cygni singer duo greats entertainer stud champ pal babe stunner hunky icon marquee friedrich bessel edward charles pickering universe spectroscopic binary friedrich georg wilhelm von struve sherburne wesley burnham orbital elements karl schwarzschild visual magnitude photographic magnitude albert abraham michelson exoplanets disc hooker telescope mount wilson observatory hertzsprung-russell diagram cecilia payne-gaposchkin quantum mechanics micrometre planck local group virgo cluster chromium local supercluster scintillation diameter arab language latin language ancient greek religion occultation absolute magnitude starspot density megastar heartthrob hottie wonderboy hoopster funnyman signee basketballer ladykiller costars wunderkind baseballer orion greek mythology roman mythology johann bayer bayer designation right ascension john flamsteed flamsteed designation apparent magnitude solar wind international astronomical union british library commercial enterprise international star registry deceptive practice sextillion new york city department of consumer affairs international system of units cgs unit candle semi-major axis lithium vacuum chamber molecular cloud o-type star life h ii region age of the earth interacting galaxy starburst galaxy jeans instability bok globule arcsecond spectroscopy pre–main sequence star protoplanetary disk t tauri star herbig ae/be star particle herbig–haro object hayashi track henyey track blue dwarf proton gradient endothermic beryllium catalyst pressure positron solar system corona opacity religion brightness sunspot power rotation history infrared wavelength photosphere frequency photon stellar population helium fusion helium flash horizontal branch red clump asymptotic giant branch r136 red supergiant carbon burning process binding energy nuclear fission wolf-rayet star radiation pressure electron-degenerate matter light year electron capture achernar inverse beta decay shock wave supernova remnant kevin spacey nick nolte joan collins matthew broderick sophia loren susan sarandon jodie foster leonardo dicaprio penelope cruz robert redford al pacino liam neeson alec baldwin robert duvall tim robbins eddie murphy sir anthony hopkins antonio banderas teri hatcher liza minnelli jim carrey tony curtis julianne moore melanie griffith jane fonda dustin hoffman drew barrymore pierce brosnan michael douglas barry manilow x-ray burster neutron-degenerate matter qcd matter roche lobe contact binaries common envelope cataclysmic variables type ia supernovae spicule heliosphere hypergiant stellar associations globular clusters observable universe space shuttle galactic spheroid blue straggler hd 140283 population iii stars mu leonis 14 herculis peculiar star hypergiant star rare earth element r doradus angular diameter angular size neutron stars orion constellation radial velocity doppler shift arc second stellar association magnetic field dynamo theory coronal loop stellar flare maunder minimum eta carinae open cluster large magellanic cloud cosmos redshift 7 2mass j0523-1403 gas giant absorption line main sequence star degenerate star color index effective temperature particle radiation binary stars alpha particle human eye cno cycle solar flare atomic nucleus gamma rays triple-alpha process proton-proton chain reaction solar eclipse radio frequency sun spots electromagnetic energy convection zone radiation zone thermal equilibrium pressure gradient beta particle mira variable cepheid variable hydrogen burning process fusion reaction hydrogen line ngc 6397 lbv 1806-20 sixth magnitude star second magnitude star first magnitude star nth root logarithmic units mass-energy equivalence uv ceti flare star limb darkening energy flux radiant energy gravitational microlensing binary system surface gravity

Popular Searches

Words Related to star

As you've probably noticed, words related to "star" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "star" are: sun, galaxy, red giant, binary star, and neutron star. There are 787 other words that are related to or similar to star listed above. Hopefully the generated list of star related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like star may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is star?

Also check out star words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of star themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr