Uv Related Words

examples: winterunderstandingcloud

Here are some words that are associated with uv: ultraviolet, sunlight, fluorescence, sunscreen, infrared, x-ray, wavelength, radiation, laser, sunburn, photolithography, skin cancer, titanium dioxide, ozone, melanin, spectrometer, electromagnetic radiation, opacity, ultraviolet radiation, ultraviolet light, ultraviolet illumination, actinic radiation, aphakia, lens, cornea, fluorescent, retina, tanning lamp, sun, illumination. You can get the definitions of these uv related words by clicking on them. Also check out describing words for uv and find more words related to uv using ReverseDictionary.org

Words Related to uv

Below is a list of words related to uv. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to uv:

ultraviolet sunlight fluorescence sunscreen infrared x-ray wavelength radiation laser sunburn photolithography skin cancer titanium dioxide ozone melanin spectrometer electromagnetic radiation opacity ultraviolet radiation ultraviolet light ultraviolet illumination actinic radiation aphakia lens cornea fluorescent retina tanning lamp sun illumination vitamin d sunray avobenzone absorbance mercury uv degradation wavelengths zinc oxide sun protection factor fused quartz thermal wood's glass photon
related words continue after advertisement
xenon flash lamp excitation deuterium arc lamp germicidal photons monochromatic photoprotection integrated circuit nonlinear optics freckle red green blue latin extreme ultraviolet lithography reactivity phz thz radiometer nitrogen human skin color sun tan indirect dna damage star album polymers uvb paints sun-ray photodiode photocathode photomultiplier esa ionizing thymine dimer pyrimidine dimers nixt mssta phosphor lasers emitting photolysis argon absorption nucleotide excision repair absorbs irradiation refraction reflectivity reflectance refractive emit oxybenzone emitted spf visible light modulators filters attenuation electric arc leds detectable mercury-vapor lamp humidity spectroscopy microscopy diodes black light logbook tunable photon energy volumetric cerium ionization energies of the elements dopant chemical reaction diffraction optical pigment sun tanning coating microwaves emits antimicrobial pollutant electromagnetic vapor filter thermometers paramagnetic saturation reactive oxygen species dermatology iodine refracted bird vision diode perspiration blinding conductivity emission ultra-violet chlorophyll androgen record detectors stratospheric permeability bookkeeper coatings pollutants uva perfusion dispersive cfcs x-rays phonons absorbent sunscreens johann wilhelm ritter silver chloride audiobook ledger john william draper insulin register actinic ray victor schumann electromagnetic spectrum iso standard blurb photosensitive cd globulin highlight ep cherenkov collagen backscatter photoreceptor cell euv melanoma camcorder transmittance semiconductor manufacturing infra-red registry unrecorded circular dichroism videotape valence electron studbook uv-b mp3 bremsstrahlung fluoresce songbook multilayer optics tape pyrimidine trachoma mixtape chronicle scrapbook cassette keratectomy normal incidence backlight hepa maldi archive illuminate apoptosis gramophone irradiance registration black-body radiation birefringence mutation recordable chlorofluorocarbons videocassette fluoroscopy registrar luminescent recorder searchlight lp solar constant luminescence workbook rayleigh scattering disc holography lamplight floodlit photogenic sunlit lux candlelight relight hymnal lightness phonograph lightly vinyl torchlight phosphorescent coruscant bookkeeping photoflash octyl methoxycinnamate organic compound photoresist sun protective clothing cataract photofluorography audiotape photobook potterholic pottermaniac videodisc soda lime glass sensitometer cashbook phonodisc 45 transparency and translucency 78 recordless photoflood microgroove oscillogram eyeglasses prerecord bologram tapesponding neurorecording spirogram telerecorded fakebook polycarbonate bankbook holorecording chromatogram chromatrope unfile stereogram cinefilm lightish recordkeeper tapescript xenon arc lamp thermoplastic potterite tapespondent paleorecord metal-halide lamp daybook tungsten-halogen lamp pigments recordset counterglow historify dyes registree photodynamic paintings recordkeeping photoguide mercury vapor lamp photic sacrist reregister lightscape holophote sciolto photooxidation halation illuminance regest autofluorescent nonregistered owllight palish nonregistering overlight radiocardiogram photodrome inlighted interilluminate photoclinometer tapezine relumine lanternlight epilog lightful interreflection magnesium fluoride candleshine nonfat lightable rutilant sunniness photosynthesize excimer lamp camcording lightsomely rutilate lighttight databook downlighting collimate light-emitting diodes quartz uv curing flexi disc gas laser laser diode counterfeiting solid-state laser passports on book nitrogen gas laser watermark parish register photokeratitis excimer laser argon fluoride laser dye pterygium biochemistry pinguecula lawrence livermore national laboratory diode-pumped solid-state laser vis papyrus laser engraving oxyrhynchus ink aramid free space optics phenyl optical storage indole detergent synchrotron light source human health chemistry studio music fluorescent lamps and health nitric oxide protein eprom mineral gemstone direct dna damage immune system nir ultraviolet index visible magnetic tape phonograph record ozone depletion record album uv/vis spectroscopy long play hydrocarbon video record sound record tape record sulfur chromium dioxide book of hour hydrogen on record world record hydrazine flat file ultra epa excited state re record ammonia covalent bond electromagnetic wave ap lightning record break daylight shortwave spectral super resonance ac intra ray pulsed axial nm neutron modulation feed intrinsic downstream microwave linear lifetimes ir dc insolation duct tape book keep compact disk semiconductor memory device find footage for record cd burner tape recorder reel to reel alkylbenzenesulfonate light source musical score white light on camera write record adhesive tape adhesive polymerization digital camera black book essential listen light thing song of song half light spectrofluorometer balance sheet printing video camera store information ear candy theater light cross file emergency light thymine enzymes proteins reptile liver psoriasis fauna nocturnal collect entomologists genetics nanometer pasteurization polymer wastewater disinfection sterilization hydrocarbons spores mold pathogens oxidation iron led meiosis mitosis microorganisms source of illumination describe video potential health risks of sunscreen stratum corneum protective eyewear h2o2 uvr paba polymer degradation collimated xray watercolour painting picture framing glass ultraviolet astronomy corona discharge nitrogen oxide psoralens frameshifting vitiligo photocatalysis excimer psoralen pollens hydrophobicity optical brightener blacklight paint phosphor banded stamp forensic science pepper spray nondestructive testing liquid penetrant magnetic-particle inspection villa of the papyri archimedes palimpsest chemical structure conjugated system quantification of nucleic acids oil spill raman scattering silicon carbide aluminium nitride artificial light thermal radiation earth's atmosphere arc welding printed circuit board optical fiber uv coating uv lamps volatile organic compound ultraviolet communication in butterflies surface energy disinfection robot poly(methyl methacrylate) surface roughness puva therapy carbon monoxide green fluorescent protein bug zapper evolutionary theory solar water disinfection thymine dimers colias eurytheme protein synthesis mercury-vapor lamps water treatment ultraviolet lamp skin conditions

Popular Searches

Words Related to uv

As you've probably noticed, words related to "uv" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "uv" are: ultraviolet, sunlight, fluorescence, sunscreen, and infrared. There are 578 other words that are related to or similar to uv listed above. Hopefully the generated list of uv related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like uv may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is uv?

Also check out uv words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of uv themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr