Aland Related Words

examples: winterunderstandingcloud

Here are some words that are associated with aland: swedish language, finnish language, skerry, archipelago, sweden, gulf of bothnia, conscription, regions of finland, fasta åland, archipelago sea, government of åland, league of nations, åland crisis, european union, parliament of finland, mariehamn, finland, overland, land, rangeland, landward, landlocked, moorland, foreland, wildland, swampland, flatland, landman, bottomland, merland. You can get the definitions of these aland related words by clicking on them. Also check out describing words for aland and find more words related to aland using ReverseDictionary.org

Words Related to aland

Below is a list of words related to aland. You can click words for definitions. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for common-ish words. Here's the list of words that are related to aland:

swedish language finnish language skerry archipelago sweden gulf of bothnia conscription regions of finland fasta åland archipelago sea government of åland league of nations åland crisis european union parliament of finland mariehamn finland overland land rangeland landward landlocked moorland foreland wildland swampland flatland landman bottomland merland duneland bogland contiguity coastland reland elfland caneland northland glebe landly federacy landlubber
related words continue after advertisement
shareland folkland landscrip monoglottism wonderland shoreland beland muckland beachfront badlands playland croftland neckland birthland landlock hinterland ashore paddyland grind permafrost terrene märket farmstead agrarian perch onshore welshland cognate disembark bookland grazeland ground mainland desertland landmass atterration homeland monopole subsoil terrestrially propertied crofting oxbow soil terrain backland fallow landfall grindcore vikings landbound aground force land heath russia proto-norse topsoil glebe land highland lander bordland belly land landrush landfarming landflood earthy landwaiter baltic sea masher demesne tellurian earthen preground grindingly territory loam upland demilitarized zone diatomite warlott earthly isthmus terrestrial wetland mill reentry croft dry land earthward island landslide groundworker groundable craton grindery no man's land earth headland byground terra terran geography beachhead dojin industrialist peninsula aboveground inshore quern belowground arrival terracotta peacekeeping dirt terraceous attritional cumberground build on whites soilless earthless undershoot landfyrd cotillage groundly powderize cultivate land understratum merestead unsoiling earthscape earthling earthboard terra firma earthican earther podzol earthlight earthwoman groundburst soily smirch sovereignty cosinage regosol finnish defence forces soal solwy geoengineering groundshare pedosphere european community treaty oran crash land estonian language grow crop saaremaa gotland schiedam pori gelderland faroese sverige kuopio chios vaasa schwyz neolithic oudenaarde bornholm tartu cephalonia antwerpen padda anvers rovaniemi bere morbihan harpa kekkonen erna iom kempis svalbard frisian skien apollinaris aalto atli pardubice allier mayenne bragi hrvatska vaudois indre thurgau lucania islay finnmark fisa akureyri spitzbergen wismar mytilene bearn dordrecht kempen achaia kristianstad koek liberec rouet norsk comb ceramic grind tissue last glacial period stone age callsign bronze age earth floor under foot iron age homeschooling diatomaceous earth real property terra incognita land mine stockholm treaty of fredrikshamn touch down many country autonomous entity grind cover limnos lolland steiermark bozcaada ystad velsen oland keijo psara thuringen pittas reest iraklion malagash pierides ingemar lappland hogh bergama mokka nordland sillanpaa ijsselmeer syros saronic tokaj ouzo sild portree smitt courland currach liepaja seram grand duchy of finland estate agent real estate bomarsund, åland grind rent our planet this world blue planet baltic theatre of the crimean war geographical region 7 continent tenant farmer desert soil crimean war plot of land seven continent life zone treaty of paris oblate spheroid land mass one moon run aground native soil tumble mill free bench finnish civil war air to grind finnish socialist workers' republic baltic sea division senate of finland åland status referendum, 1919 russification of finland åboland finland's language strife euro pommern eurostat swedes world war ii parliament of åland parliamentary system nordic council air åland aland islands wiener neustadt lake balaton lake onega sint maarten inner hebrides small european postal administration cooperation amateur radio berghamn långnäs itu prefix åland state provincial office gulf of finland sea of åland bothnian sea mainland finland tourism in åland åland swedish mariehamn airport swedish krona official language first language gustaf erikson grain race swedish-speaking population of finland uppländska dialect finland swedish languages of sweden evangelical lutheran church of finland st. olaf's church, jomala sund, åland

Popular Searches

Words Related to aland

As you've probably noticed, words related to "aland" are listed above. According to the algorithm that drives this word similarity engine, the top 5 related words for "aland" are: swedish language, finnish language, skerry, archipelago, and sweden. There are 379 other words that are related to or similar to aland listed above. Hopefully the generated list of aland related words above suit your needs.

P.S. There are some problems that I'm aware of, but can't currently fix (because they are out of the scope of this project). The main one is that individual words can have many different senses (meanings), so when you search for a word like mean, the engine doesn't know which definition you're referring to ("bullies are mean" vs. "what do you mean?", etc.), so consider that your search query for words like aland may be a bit ambiguous to the engine in that sense, and the related terms that are returned may reflect this. You might also be wondering: What type of word is aland?

Also check out aland words on relatedwords.io for another source of associations.

Related Words

Related Words runs on several different algorithms which compete to get their results higher in the list. One such algorithm uses word embedding to convert words into many dimensional vectors which represent their meanings. The vectors of the words in your query are compared to a huge database of of pre-computed vectors to find similar words. Another algorithm crawls through Concept Net to find words which have some meaningful relationship with your query. These algorithms, and several more, are what allows Related Words to give you... related words - rather than just direct synonyms.

As well as finding words related to other words, you can enter phrases and it should give you related words and phrases, so long as the phrase/sentence you entered isn't too long. You will probably get some weird results every now and then - that's just the nature of the engine in its current state.

Special thanks to the contributors of the open-source code that was used to bring you this list of aland themed words: @Planeshifter, @HubSpot, Concept Net, WordNet, and @mongodb.

There is still lots of work to be done to get this to give consistently good results, but I think it's at the stage where it could be useful to people, which is why I released it.

Please note that Related Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

befikikinseycybergirllentiaringtailabidjanintimejianchuanpalakdiglymeimplorabumpysmodysolntsevolycopolisexpeditedballinasloemassivegoodcoagulantstricholaenaglasgowbramhinharrodsflawekhandsaprimaloftarmyscutelinewinterwearcoauthorrentablejiliancusaesammsammanmuhandirammaingitarkucingmonkeyskolsammanthacoqqphotosensitisezarzapashtrikethnographersphaunouxiteastetixkuravanmalaarmeniabystrowianahungarorumkirstentokiohotlkevelaerphyllitisphotoresfhskerkennkhotakotanyanplasmodiophoraceaeestrelladburonisothermobathmuminsniersmorganacutecoekskavatorfascisusarspatinodromesbayouorthoschemequintettebehaviorqqqqrwisakovsbionwalloonsbhatrajudurometerbarowariredditdanriohysterisisproailuruscutecootpontianspotamicblipvertlimousinedirecbluberryrollerbladingsentrysafeinstagramanriochasmosaurinaesaffraninerollerskatingwatchgetaroundspacepalaearcticphotovoltattopsammapapastratoscratloenavoixoxodaejongismmainovacomplexionsantoorsambhaavsteaisteardipavansafecalbusyloompanicswntbrundlewietzendorflxxviieidstodmillilitrehydrocarbylmegalograptuskykkelsrudhargshamnwaschbeckenwftqvallombrosatwilimyariaethyleneiminepanathinaikosmiglitolhennsetswimathonfinswimmingfullereneyodanatwestsweamswimmableumiatmandrostratusdunstanmisintomyopiasuperlitiohwacheonmeundiesbodaitransvaalersghulmanviglenikjanbullestormsachirbrahmotsavaminykhnumelectrobatefyarestaurangerlightingmimorudiviridaeargentinobowmensamaalbhikshunifucjkyarsanismgulagsagromeasurementchordomatpescisplatinligjtknapripeelcesaiteshalghamlightseriphosresectableardashirgirdedchromoblastpolyglutamylationelectricfrontstretchsalesditchinghamnaryshkinkneadedmittondpr